• Gene id: 54600

Gene Summary

• Gene Symbol: UGT1A9   Gene   UCSC   Ensembl
• Aliases: HLUGP4, LUGP4, UDPGT, UDPGT 1-9, UGT-1I, UGT1-09, UGT1-9, UGT1.9, UGT1A9S, UGT1AI, UGT1I
• Gene name: UDP glucuronosyltransferase family 1 member A9
• Alternate names: UDP-glucuronosyltransferase 1-9, UDP glucuronosyltransferase 1 family, polypeptide A9, UDP glycosyltransferase 1 family, polypeptide A9, UDP-glucuronosyltransferase 1 family polypeptide A9s, UDP-glucuronosyltransferase 1-I, UDP-glucuronosyltransferase 1A9,
• Gene location: 2q37.1 (233671897: 233773299)     Exons: 5     NC_000002.12
• Gene summary(Entrez): This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp
• OMIM: 606428

Protein Summary

• Protein general information: O60656  
  • Name: UDP glucuronosyltransferase 1 9 (UDPGT 1 9) (UGT1*9) (UGT1 09) (UGT1.9) (EC 2.4.1.17) (UDP glucuronosyltransferase 1 I) (UGT 1I) (UGT1I) (UDP glucuronosyltransferase 1A9) (lugP4)
  • Length: 530  
  • Mass: 59941
  • Tissue specificity: Liver. Isoform 1 and isoform 2 are expressed in liver, kidney, colon, esophagus and small intestine. {ECO
• Sequence:

  MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLGRSLNCTVK
  TYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPF
  DNCGLIVAKYFSLPSVVFARGILCHYLEEGAQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLLCHRFFK
  NALEIASEILQTPVTEYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
  VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGV
  YESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPVE
  PLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAH
  KSKTH

• Structural information:
  • Interpro: IPR002213  IPR035595  
  • Prosite: PS00375
  • STRING: ENSP00000346768
• Other Databases: GeneCards:  UGT1A9  Malacards:  UGT1A9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0052696	flavonoid glucuronidation	IBA	biological process
GO:0052697	xenobiotic glucuronidation	IBA	biological process
GO:0008194	UDP-glycosyltransferase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015020	glucuronosyltransferase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0015020	glucuronosyltransferase activity	IDA	molecular function
GO:0015020	glucuronosyltransferase activity	IDA	molecular function
GO:0015020	glucuronosyltransferase activity	IDA	molecular function
GO:0001972	retinoic acid binding	IDA	molecular function
GO:0042573	retinoic acid metabolic process	IC	biological process
GO:0052697	xenobiotic glucuronidation	IDA	biological process
GO:0051552	flavone metabolic process	IDA	biological process
GO:0052696	flavonoid glucuronidation	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0052695	cellular glucuronidation	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0015020	glucuronosyltransferase activity	IDA	molecular function
GO:0019899	enzyme binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00983	Drug metabolism - other enzymes
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa00830	Retinol metabolism
hsa00140	Steroid hormone biosynthesis
hsa00860	Porphyrin and chlorophyll metabolism
hsa00040	Pentose and glucuronate interconversions
hsa00053	Ascorbate and aldarate metabolism

Diseases

Associated diseases	References
cholangiocarcinoma	PMID:9230212
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq