• Gene id: 54587

Gene Summary

• Gene Symbol: MXRA8   Gene   UCSC   Ensembl
• Aliases: ASP3
• Gene name: matrix remodeling associated 8
• Alternate names: matrix remodeling-associated protein 8, limitrin, matrix-remodeling-associated protein 8, matrix-remodelling associated 8,
• Gene location: 1p36.33 (94390653: 94376746)     Exons: 7     NC_000014.9
• OMIM: 107280

Protein Summary

• Protein general information: Q9BRK3  
  • Name: Matrix remodeling associated protein 8 (Limitrin)
  • Length: 442  
  • Mass: 49132
  • Tissue specificity: Detected in endothelial cells in mammary tissue, in both large vessels (left internal mammary artery) and small capillaries (vasa vasorum of the adventitia). {ECO
• Sequence:

  MALPSRILLWKLVLLQSSAVLLHSGSSVPAAAGSSVVSESAVSWEAGARAVLRCQSPRMVWTQDRLHDRQRVLHW
  DLRGPGGGPARRLLDLYSAGEQRVYEARDRGRLELSASAFDDGNFSLLIRAVEETDAGLYTCNLHHHYCHLYESL
  AVRLEVTDGPPATPAYWDGEKEVLAVARGAPALLTCVNRGHVWTDRHVEEAQQVVHWDRQPPGVPHDRADRLLDL
  YASGERRAYGPLFLRDRVAVGADAFERGDFSLRIEPLEVADEGTYSCHLHHHYCGLHERRVFHLTVAEPHAEPPP
  RGSPGNGSSHSGAPGPDPTLARGHNVINVIVPESRAHFFQQLGYVLATLLLFILLLVTVLLAARRRRGGYEYSDQ
  KSGKSKGKDVNLAEFAVAAGDQMLYRSEDIQLDYKNNILKERAELAHSPLPAKYIDLDKGFRKENCK

• Structural information:
  • Protein Domains: (29..15-)
    1 (/note="Ig-like-V-type)
    (160..28-)
    2" (/note="Ig-like-V-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106   IPR042472  
  • Prosite: PS50835
  • PDB: 6JO8
  • PDBsum: 6JO8
  • STRING: ENSP00000399229
• Other Databases: GeneCards:  MXRA8  Malacards:  MXRA8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060857	establishment of glial blood-brain barrier	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0060170	ciliary membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0060857	establishment of glial blood-brain barrier	ISS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0009986	cell surface	ISS	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R