• Gene id: 5458

Gene Summary

• Gene Symbol: POU4F2   Gene   UCSC   Ensembl
• Aliases: BRN3.2, BRN3B, Brn-3b
• Gene name: POU class 4 homeobox 2
• Alternate names: POU domain, class 4, transcription factor 2, Brn3b POU domain transcription factor, POU domain protein, brain-3B, brain-specific homeobox/POU domain protein 3B,
• Gene location: 4q31.22 (146638892: 146642473)     Exons: 2     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the POU-domain transcription factor family and may be involved in maintaining visual system neurons in the retina. The level of the encoded protein is also elevated in a majority of breast cancers, resulting
• OMIM: 618206

Protein Summary

• Protein general information: Q12837  
  • Name: POU domain, class 4, transcription factor 2 (Brain specific homeobox/POU domain protein 3B) (Brain 3B) (Brn 3B)
  • Length: 409  
  • Mass: 43087
  • Tissue specificity: Expressed in the brain (PubMed
• Sequence:

  MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSSSNAGGGGGGGGGGGGGGGRSSSSSS
  SGSSGGGGSEAMRRACLPTPPSNIFGGLDESLLARAEALAAVDIVSQSKSHHHHPPHHSPFKPDATYHTMNTIPC
  TSAASSSSVPISHPSALAGTHHHHHHHHHHHHQPHQALEGELLEHLSPGLALGAMAGPDGAVVSTPAHAPHMATM
  NPMHQAALSMAHAHGLPSHMGCMSDVDADPRDLEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTIC
  RFESLTLSHNNMIALKPILQAWLEEAEKSHREKLTKPELFNGAEKKRKRTSIAAPEKRSLEAYFAIQPRPSSEKI
  AAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAGI

• Structural information:
  • Protein Domains: (250..32-)
    (/note="POU-specific-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00530"-)
  • Interpro: IPR001387  IPR009057  IPR017970  IPR001356  IPR010982   IPR013847  IPR000327  
  • Prosite: PS00027 PS50071 PS00035 PS00465 PS51179
  • CDD: cd00086 cd00093
  • STRING: ENSP00000281321
• Other Databases: GeneCards:  POU4F2  Malacards:  POU4F2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS	molecular function
GO:0007507	heart development	ISS	biological process
GO:0005667	transcription regulator complex	IGI	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0016607	nuclear speck	IDA	cellular component
GO:1990841	promoter-specific chromatin binding	ISS	molecular function
GO:0045672	positive regulation of osteoclast differentiation	ISS	biological process
GO:0045596	negative regulation of cell differentiation	ISS	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	ISS	biological process
GO:2000679	positive regulation of transcription regulatory region DNA binding	ISS	biological process
GO:0071392	cellular response to estradiol stimulus	ISS	biological process
GO:0051090	regulation of DNA-binding transcription factor activity	ISS	biological process
GO:1990841	promoter-specific chromatin binding	ISS	molecular function
GO:0072332	intrinsic apoptotic signaling pathway by p53 class mediator	ISS	biological process
GO:0043068	positive regulation of programmed cell death	ISS	biological process
GO:1990791	dorsal root ganglion development	ISS	biological process
GO:0045773	positive regulation of axon extension	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0071345	cellular response to cytokine stimulus	ISS	biological process
GO:0003714	transcription corepressor activity	ISS	molecular function
GO:1902870	negative regulation of amacrine cell differentiation	ISS	biological process
GO:0003713	transcription coactivator activity	ISS	molecular function
GO:0090259	regulation of retinal ganglion cell axon guidance	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902870	negative regulation of amacrine cell differentiation	IEA	biological process
GO:0090259	regulation of retinal ganglion cell axon guidance	IEA	biological process
GO:0071345	cellular response to cytokine stimulus	IEA	biological process
GO:0046326	positive regulation of glucose import	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0030182	neuron differentiation	IEA	biological process
GO:0007605	sensory perception of sound	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005719	nuclear euchromatin	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:1990841	promoter-specific chromatin binding	IEA	molecular function
GO:1990791	dorsal root ganglion development	IEA	biological process
GO:1904178	negative regulation of adipose tissue development	IEA	biological process
GO:0060041	retina development in camera-type eye	IEA	biological process
GO:0050885	neuromuscular process controlling balance	IEA	biological process
GO:0048675	axon extension	IEA	biological process
GO:0045773	positive regulation of axon extension	IEA	biological process
GO:0045672	positive regulation of osteoclast differentiation	IEA	biological process
GO:0045597	positive regulation of cell differentiation	IEA	biological process
GO:0045596	negative regulation of cell differentiation	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0031290	retinal ganglion cell axon guidance	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0002039	p53 binding	IEA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0071453	cellular response to oxygen levels	IEA	biological process
GO:0010666	positive regulation of cardiac muscle cell apoptotic process	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000165	MAPK cascade	IDA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0030520	intracellular estrogen receptor signaling pathway	IDA	biological process
GO:0005634	nucleus	IC	cellular component
GO:0045597	positive regulation of cell differentiation	ISS	biological process
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS	molecular function
GO:0060041	retina development in camera-type eye	ISS	biological process
GO:0030182	neuron differentiation	ISS	biological process
GO:0007411	axon guidance	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray