• Gene id: 54579

Gene Summary

• Gene Symbol: UGT1A5   Gene   UCSC   Ensembl
• Aliases: UDPGT, UDPGT 1-5, UGT1E
• Gene name: UDP glucuronosyltransferase family 1 member A5
• Alternate names: UDP-glucuronosyltransferase 1-5, UDP glucuronosyltransferase 1 family, polypeptide A5, UDP glycosyltransferase 1 family, polypeptide A5, UDP-glucuronosyltransferase 1 family polypeptide A5s, UDP-glucuronosyltransferase 1-E, UDP-glucuronosyltransferase 1A5, UGT-,
• Gene location: 2q37.1 (233712991: 233773298)     Exons: 5     NC_000002.12
• Gene summary(Entrez): This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp
• OMIM: 606434

Protein Summary

• Protein general information: P35504  
  • Name: UDP glucuronosyltransferase 1 5 (UDPGT 1 5) (UGT1*5) (UGT1 05) (UGT1.5) (EC 2.4.1.17) (UDP glucuronosyltransferase 1 E) (UGT 1E) (UGT1E) (UDP glucuronosyltransferase 1A5)
  • Length: 534  
  • Mass: 60071
  • Tissue specificity: Isoform 1 and isoform 2 are expressed in colon and small intestine. Neither isoform is expressed in liver, kidney or esophagus. {ECO
• Sequence:

  MATGLQVPLPQLATGLLLLLSVQPWAESGKVLVVPTDGSHWLSMREALRDLHARGHQVVVLTLEVNMYIKEENFF
  TLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNMSLIIHRSCVELLHNEALIRHLHATSFDVVL
  TDPFHLCAAVLAKYLSIPAVFFLRNIPCDLDFKGTQCPNPSSYIPRLLTTNSDHMTFLQRVKNMLYPLALSYLCH
  AVSAPYASLASELFQREVSVVDLVSHASVWLFRGDFVMDYPRPIMPNMVFIGGINCANGKPLSQEFEAYINASGE
  HGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAG
  SHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKD
  RPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRV
  KKAHKSKTH

• Structural information:
  • Interpro: IPR002213  IPR035595  
  • Prosite: PS00375
  • STRING: ENSP00000362513
• Other Databases: GeneCards:  UGT1A5  Malacards:  UGT1A5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008194	UDP-glycosyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0015020	glucuronosyltransferase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00983	Drug metabolism - other enzymes
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa00830	Retinol metabolism
hsa00140	Steroid hormone biosynthesis
hsa00860	Porphyrin and chlorophyll metabolism
hsa00040	Pentose and glucuronate interconversions
hsa00053	Ascorbate and aldarate metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq