Male Infertility Database

Search Result

Gene id

54578

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

UGT1A6 Gene UCSC Ensembl

Aliases

GNT1, HLUGP, HLUGP1, UDPGT, UDPGT 1-6, UGT-1A, UGT-1C, UGT-1E, UGT1, UGT1-01, UGT1-03, UGT1-05, UGT1.1, UGT1.3, UGT1.5, UGT1A, UGT1A1, UGT1A3, UGT1A5, UGT1A6S, UGT1C, UGT1E, UGT1F, hUG-BR1

Gene name

UDP glucuronosyltransferase family 1 member A6

Alternate names

UDP-glucuronosyltransferase 1-6, Bilirubin-specific UDPGT isozyme 1, UDP glucuronosyltransferase 1 family, polypeptide A6, UDP glycosyltransferase 1 family, polypeptide A6, UDP-glucuronosyltransferase 1 family polypeptide A6s, UDP-glucuronosyltransferase 1-1, U,

Gene location

2q37.1 (233691669: 233773299) Exons: 6 NC_000002.12

Gene summary(Entrez)

This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp

OMIM

606430

Protein Summary

Protein general information

P19224

Name: UDP glucuronosyltransferase 1 6 (UDPGT 1 6) (UGT1*6) (UGT1 06) (UGT1.6) (EC 2.4.1.17) (Phenol metabolizing UDP glucuronosyltransferase) (UDP glucuronosyltransferase 1 F) (UGT 1F) (UGT1F) (UDP glucuronosyltransferase 1A6)

Length: 532 Mass: 60751

Tissue specificity: Expressed in skin. Isoforms 1 and 3 are expressed in kidney and liver. Isoform 1 but not isoform 2 is expressed in colon, esophagus and small intestine. {ECO

Sequence

MACLLRSFQRISAGVFFLALWGMVVGDKLLVVPQDGSHWLSMKDIVEVLSDRGHEIVVVVPEVNLLLKESKYYTR
KIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLYFINCQSLLQDRDTLNFFKESKFDALFTD
PALPCGVILAEYLGLPSVYLFRGFPCSLEHTFSRSPDPVSYIPRCYTKFSDHMTFSQRVANFLVNLLEPYLFYCL
FSKYEELASAVLKRDVDIITLYQKVSVWLLRYDFVLEYPRPVMPNMVFIGGINCKKRKDLSQEFEAYINASGEHG
IVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSH
GVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRP
VEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKK
AHKSKTH

Structural information

Interpro:	IPR002213 IPR035595
Prosite:	PS00375
STRING:	ENSP00000303174

Other Databases

GeneCards: UGT1A6 Malacards: UGT1A6

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0052696	flavonoid glucuronidation	IBA	biological process
GO:0052697	xenobiotic glucuronidatio n	IBA	biological process
GO:0008194	UDP-glycosyltransferase a ctivity	IEA	molecular function
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0016757	transferase activity, tra nsferring glycosyl groups	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0015020	glucuronosyltransferase a ctivity	IEA	molecular function
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0052695	cellular glucuronidation	TAS	biological process
GO:0001972	retinoic acid binding	IDA	NOT\|molecular function
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular component
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular component
GO:0052695	cellular glucuronidation	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0015020	glucuronosyltransferase a ctivity	IDA	molecular function
GO:0006805	xenobiotic metabolic proc ess	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00983	Drug metabolism - other enzymes
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa00830	Retinol metabolism
hsa00140	Steroid hormone biosynthesis
hsa00860	Porphyrin and chlorophyll metabolism
hsa00040	Pentose and glucuronate interconversions
hsa00053	Ascorbate and aldarate metabolism

Diseases

Expand All | Collapse All

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

Expand All | Collapse All

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
28606200	Cryptorchi dism			Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract
28606200	Cryptorchi dism			Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All