• Gene id: 54577

Gene Summary

• Gene Symbol: UGT1A7   Gene   UCSC   Ensembl
• Aliases: GNT1, UDPGT, UDPGT 1-7, UGT-1A, UGT-1G, UGT1, UGT1-01, UGT1-07, UGT1.1, UGT1.7, UGT1A, UGT1A1, UGT1G, hUG-BR1
• Gene name: UDP glucuronosyltransferase family 1 member A7
• Alternate names: UDP-glucuronosyltransferase 1-7, Bilirubin-specific UDPGT isozyme 1, UDP glucuronosyltransferase 1 family, polypeptide A7, UDP glycosyltransferase 1 family, polypeptide A7, UDP-glucuronosyltransferase 1 family polypeptide A7s, UDP-glucuronosyltransferase 1-1, U,
• Gene location: 2q37.1 (233681937: 233773298)     Exons: 5     NC_000002.12
• Gene summary(Entrez): This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp
• OMIM: 606431

Protein Summary

• Protein general information: Q9HAW7  
  • Name: UDP glucuronosyltransferase 1 7 (UDPGT 1 7) (UGT1*7) (UGT1 07) (UGT1.7) (EC 2.4.1.17) (UDP glucuronosyltransferase 1 G) (UGT 1G) (UGT1G) (UDP glucuronosyltransferase 1A7)
  • Length: 530  
  • Mass: 59819
  • Tissue specificity: Liver and gastric tissue. Isoform 1 and isoform 2 are expressed in esophagus. Neither isoform is expressed in liver, kidney, colon and small intestine (PubMed
• Sequence:

  MARAGWTGLLPLYVCLLLTCGFAKAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLGRSLNCTVK
  TYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSNCRSLFNDRKLVEYLKESCFDAVFLDPF
  DACGLIVAKYFSLPSVVFARGIFCHYLEEGAQCPAPLSYVPRLLLGFSDAMTFKERVWNHIMHLEEHLFCPYFFK
  NVLEIASEILQTPVTAYDLYSHTSIWLLRTDFVLEYPKPVMPNMIFIGGINCHQGKPVPMEFEAYINASGEHGIV
  VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGV
  YESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPVE
  PLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAH
  KSKTH

• Structural information:
  • Interpro: IPR002213  IPR035595  
  • Prosite: PS00375
  • STRING: ENSP00000362525
• Other Databases: GeneCards:  UGT1A7  Malacards:  UGT1A7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0052697	xenobiotic glucuronidation	IBA	biological process
GO:0052696	flavonoid glucuronidation	IBA	biological process
GO:0008194	UDP-glycosyltransferase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0015020	glucuronosyltransferase activity	IEA	molecular function
GO:0004857	enzyme inhibitor activity	IDA	molecular function
GO:0005080	protein kinase C binding	IDA	molecular function
GO:0015020	glucuronosyltransferase activity	IDA	molecular function
GO:0015020	glucuronosyltransferase activity	IDA	molecular function
GO:0015020	glucuronosyltransferase activity	IDA	molecular function
GO:0015020	glucuronosyltransferase activity	IDA	molecular function
GO:0001972	retinoic acid binding	IDA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0007588	excretion	IC	biological process
GO:0017144	drug metabolic process	IC	biological process
GO:0042573	retinoic acid metabolic process	IC	biological process
GO:0052697	xenobiotic glucuronidation	IDA	biological process
GO:0009804	coumarin metabolic process	IC	biological process
GO:0051552	flavone metabolic process	IC	biological process
GO:0052696	flavonoid glucuronidation	IDA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0052695	cellular glucuronidation	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0015020	glucuronosyltransferase activity	IDA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00983	Drug metabolism - other enzymes
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa00830	Retinol metabolism
hsa00140	Steroid hormone biosynthesis
hsa00860	Porphyrin and chlorophyll metabolism
hsa00040	Pentose and glucuronate interconversions
hsa00053	Ascorbate and aldarate metabolism

Diseases

Associated diseases	References
pancreatic cancer	PMID:12806614
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq