• Gene id: 54575

Gene Summary

• Gene Symbol: UGT1A10   Gene   UCSC   Ensembl
• Aliases: GNT1, UDPGT, UGT-1A, UGT-1J, UGT1, UGT1-01, UGT1-10, UGT1.1, UGT1.10, UGT1A, UGT1A1, UGT1J, hUG-BR1
• Gene name: UDP glucuronosyltransferase family 1 member A10
• Alternate names: UDP-glucuronosyltransferase 1-10, Bilirubin-specific UDPGT isozyme 1, UDP glucuronosyltransferase 1 family, polypeptide A10, UDP glycosyltransferase 1 family, polypeptide A10, UDP-glucuronosyltransferase 1-1, UDP-glucuronosyltransferase 1-A, UDP-glucuronosyltra,
• Gene location: 2q37.1 (233636476: 233773304)     Exons: 5     NC_000002.12
• Gene summary(Entrez): This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp
• OMIM: 606432

Protein Summary

• Protein general information: Q9HAW8  
  • Name: UDP glucuronosyltransferase 1 10 (UDPGT 1 10) (UGT1*10) (UGT1 10) (UGT1.10) (EC 2.4.1.17) (UDP glucuronosyltransferase 1 J) (UGT 1J) (UGT1J) (UDP glucuronosyltransferase 1A10)
  • Length: 530  
  • Mass: 59810
  • Tissue specificity: Liver and colon. Isoform 1 and isoform 2 are expressed in colon, esophagus and small intestine; isoform 2 but not isoform 1 is expressed in liver or kidney (PubMed
• Sequence:

  MARAGWTSPVPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLERSLNCTVK
  TYSTSYTLEDQNREFMVFAHAQWKAQAQSIFSLLMSSSSGFLDLFFSHCRSLFNDRKLVEYLKESSFDAVFLDPF
  DTCGLIVAKYFSLPSVVFTRGIFCHHLEEGAQCPAPLSYVPNDLLGFSDAMTFKERVWNHIVHLEDHLFCQYLFR
  NALEIASEILQTPVTAYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
  VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGV
  YESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPVE
  PLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAH
  KSKTH

• Structural information:
  • Interpro: IPR002213  IPR035595  
  • Prosite: PS00375
  • STRING: ENSP00000343838
• Other Databases: GeneCards:  UGT1A10  Malacards:  UGT1A10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0052697	xenobiotic glucuronidation	IBA	biological process
GO:0052696	flavonoid glucuronidation	IBA	biological process
GO:0008194	UDP-glycosyltransferase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015020	glucuronosyltransferase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0015020	glucuronosyltransferase activity	TAS	molecular function
GO:0052695	cellular glucuronidation	TAS	biological process
GO:0005080	protein kinase C binding	IDA	molecular function
GO:0015020	glucuronosyltransferase activity	IDA	molecular function
GO:0015020	glucuronosyltransferase activity	IDA	molecular function
GO:0001972	retinoic acid binding	IDA	NOT|molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0052695	cellular glucuronidation	IDA	biological process
GO:0051552	flavone metabolic process	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00983	Drug metabolism - other enzymes
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa00830	Retinol metabolism
hsa00140	Steroid hormone biosynthesis
hsa00860	Porphyrin and chlorophyll metabolism
hsa00040	Pentose and glucuronate interconversions
hsa00053	Ascorbate and aldarate metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq