• Gene id: 54556

Gene Summary

• Gene Symbol: ING3   Gene   UCSC   Ensembl
• Aliases: Eaf4, ING2, MEAF4, p47ING3
• Gene name: inhibitor of growth family member 3
• Alternate names: inhibitor of growth protein 3,
• Gene location: 7q31.31 (120950748: 120977215)     Exons: 10     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodelin
• OMIM: 607493

Protein Summary

• Protein general information: Q9NXR8  
  • Name: Inhibitor of growth protein 3 (p47ING3)
  • Length: 418  
  • Mass: 46743
  • Tissue specificity: Expressed in brain, heart, kidney, liver, lung, ovaries, placenta, prostate, skeletal muscle, small intestine, spleen, testis and thymus.
• Sequence:

  MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALED
  ADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHAHSHTPVEKRKYN
  PTSHHTTTDHIPEKKFKSEALLSTLTSDASKENTLGCRNNNSTASSNNAYNVNSSQPLGSYNIGSLSSGTGAGAI
  TMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKEFSMARETVGYSSSSALMTTLTQNASSSAADSRSGR
  KSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQTTVVPESDSNSQVDWTYDPNEPRYCICNQVSYGEMVG
  CDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK

• Structural information:
  • Interpro: IPR042020  IPR028651  IPR024610  IPR019786  IPR011011   IPR001965  IPR019787  IPR013083  
  • Prosite: PS01359 PS50016
  • CDD: cd15585
  • PDB: 1X4I
  • PDBsum: 1X4I
  • DIP: 34303
  • STRING: ENSP00000320566
• Other Databases: GeneCards:  ING3  Malacards:  ING3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004402	histone acetyltransferase activity	IBA	contributes to
GO:0035267	NuA4 histone acetyltransferase complex	IBA	cellular component
GO:0035064	methylated histone binding	IDA	molecular function
GO:0035064	methylated histone binding	IDA	molecular function
GO:0000812	Swr1 complex	IDA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0035267	NuA4 histone acetyltransferase complex	IDA	cellular component
GO:0004402	histone acetyltransferase activity	IDA	contributes to
GO:0043968	histone H2A acetylation	IDA	biological process
GO:0043967	histone H4 acetylation	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0032777	Piccolo NuA4 histone acetyltransferase complex	IDA	cellular component
GO:0035267	NuA4 histone acetyltransferase complex	IDA	cellular component
GO:0043968	histone H2A acetylation	IDA	biological process
GO:0043967	histone H4 acetylation	IDA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq