• Gene id: 54552

Gene Summary

• Gene Symbol: GNL3L   Gene   UCSC   Ensembl
• Aliases: GNL3B
• Gene name: G protein nucleolar 3 like
• Alternate names: guanine nucleotide-binding protein-like 3-like protein, G protein nucleolar 3B, guanine nucleotide binding protein-like 3 (nucleolar)-like, novel GTPase,
• Gene location: Xp11.22 (94973611: 94962619)     Exons: 7     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene appears to be a nucleolar GTPase that is essential for ribosomal pre-rRNA processing and cell proliferation. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, May 2010]
• OMIM: 300873

Protein Summary

• Protein general information: Q9NVN8  
  • Name: Guanine nucleotide binding protein like 3 like protein
  • Length: 582  
  • Mass: 65573
• Sequence:

  MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPNDHANREAELKKKWVEEMREKQQAAR
  EQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEATRKAYYKEFRKVVEYSDVILEVLDARDPLGC
  RCFQMEEAVLRAQGNKKLVLVLNKIDLVPKEVVEKWLDYLRNELPTVAFKASTQHQVKNLNRCSVPVDQASESLL
  KSKACFGAENLMRVLGNYCRLGEVRTHIRVGVVGLPNVGKSSLINSLKRSRACSVGAVPGITKFMQEVYLDKFIR
  LLDAPGIVPGPNSEVGTILRNCVHVQKLADPVTPVETILQRCNLEEISNYYGVSGFQTTEHFLTAVAHRLGKKKK
  GGLYSQEQAAKAVLADWVSGKISFYIPPPATHTLPTHLSAEIVKEMTEVFDIEDTEQANEDTMECLATGESDELL
  GDTDPLEMEIKLLHSPMTKIADAIENKTTVYKIGDLTGYCTNPNRHQMGWAKRNVDHRPKSNSMVDVCSVDRRSV
  LQRIMETDPLQQGQALASALKNKKKMQKRADKIASKLSDSMMSALDLSGNADDGVGD

• Structural information:
  • Protein Domains: (125..31-)
    (/note="CP-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01058"-)
  • Interpro: IPR030378  IPR023179  IPR006073  IPR027417  
  • Prosite: PS51721
  • STRING: ENSP00000338573
• Other Databases: GeneCards:  GNL3L  Malacards:  GNL3L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IBA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0033234	negative regulation of protein sumoylation	IMP	biological process
GO:0031397	negative regulation of protein ubiquitination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005697	telomerase holoenzyme complex	IDA	cellular component
GO:0031647	regulation of protein stability	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1904816	positive regulation of protein localization to chromosome, telomeric region	IDA	biological process
GO:0031647	regulation of protein stability	IDA	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0032211	negative regulation of telomere maintenance via telomerase	IMP	biological process
GO:0031334	positive regulation of protein-containing complex assembly	IMP	biological process
GO:1904816	positive regulation of protein localization to chromosome, telomeric region	IMP	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)