• Gene id: 54550

Gene Summary

• Gene Symbol: NECAB2   Gene   UCSC   Ensembl
• Aliases: EFCBP2, stip-2
• Gene name: N-terminal EF-hand calcium binding protein 2
• Alternate names: N-terminal EF-hand calcium-binding protein 2, EF-hand calcium-binding protein 2, neuronal calcium binding 2, neuronal calcium-binding protein 2, synaptotagmin-interacting protein 2,
• Gene location: 16q23.3 (83968631: 84002775)     Exons: 13     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene is a neuronal calcium-binding protein that binds to and modulates the function of at least two receptors, adenosine A(2A) receptor and metabotropic glutamate receptor type 5. [provided by RefSeq, Jul 2016]
• OMIM: 606435

Protein Summary

• Protein general information: Q7Z6G3  
  • Name: N terminal EF hand calcium binding protein 2 (EF hand calcium binding protein 2) (Neuronal calcium binding protein 2) (Synaptotagmin interacting protein 2) (Stip 2)
  • Length: 386  
  • Mass: 43194
  • Tissue specificity: Expressed in brain. Expressed in the spinal dorsal horn with especially strong expression in lamina IIi; found in excitory synaptic boutons and in ependymal cells (at protein level). {ECO
• Sequence:

  MCERAARLCRAGAHRLLREPPQQGRALGGLLRWVGARMGEPRESLAPAAPADPGPASPRGGTAVILDIFRRADKN
  DDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELCDYFVDHMGDYEDVLASLETLNHSVLKAMGY
  TKKVYEGGSNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQLRQNHIKPSHSAAQTWCGSPTPASAPNH
  KLMAMEQGKTLPSATEDAKEEGLEAQISRLAELIGRLESKALWFDLQQRLSDEDGTNMHLQLVRQEMAVCPEQLS
  EFLDSLRQYLRGTTGVRNCFHITAVRLSDGFTFVIYEFWETEEAWKRHLQSPLCKAFRHVKVDTLSQPEALSRIL
  VPAAWCTVGRD

• Structural information:
  • Protein Domains: (60..9-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (94..12-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (286..37-)
    (/note="ABM"-)
  • Interpro: IPR007138  IPR011008  IPR011992  IPR018247  IPR002048   IPR039862  
  • Prosite: PS51725 PS00018 PS50222
  • CDD: cd00051
  • STRING: ENSP00000307449
• Other Databases: GeneCards:  NECAB2  Malacards:  NECAB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0042984	regulation of amyloid precursor protein biosynthetic process	IBA	biological process
GO:0031687	A2A adenosine receptor binding	IDA	molecular function
GO:0060168	positive regulation of adenosine receptor signaling pathway	IDA	biological process
GO:1900451	positive regulation of glutamate receptor signaling pathway	IDA	biological process
GO:1905477	positive regulation of protein localization to membrane	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0031802	type 5 metabotropic glutamate receptor binding	IDA	molecular function
GO:1904021	negative regulation of G protein-coupled receptor internalization	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq