• Gene id: 54546

Gene Summary

• Gene Symbol: RNF186   Gene   UCSC   Ensembl
• Gene name: ring finger protein 186
• Alternate names: E3 ubiquitin-protein ligase RNF186,
• Gene location: 1p36.13 (19815282: 19814028)     Exons: 1     NC_000001.11
• OMIM: 170998

Protein Summary

• Protein general information: Q9NXI6  
  • Name: E3 ubiquitin protein ligase RNF186 (EC 2.3.2.27) (RING finger protein 186)
  • Length: 227  
  • Mass: 24145
• Sequence:

  MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCPRLPKLLACQHAFCAICLKLLLCVQD
  NTWSITCPLCRKVTAVPGGLICSLRDHEAVVGQLAQPCTEVSLCPQGLVDPADLAAGHPSLVGEDGQDEVSANHV
  AARRLAAHLLLLALLIILIGPFIYPGVLRWVLTFIIALALLMSTLFCCLPSTRGSCWPSSRTLFCREQKHSHISS
  IA

• Structural information:
  • Interpro: IPR038878  IPR001841  IPR013083  IPR017907  
  • Prosite: PS00518 PS50089
  • STRING: ENSP00000364263
• Other Databases: GeneCards:  RNF186  Malacards:  RNF186

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004842	ubiquitin-protein transferase activity	IBA	molecular function
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0035519	protein K29-linked ubiquitination	IBA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IBA	biological process
GO:0070534	protein K63-linked ubiquitination	IBA	biological process
GO:0070585	protein localization to mitochondrion	IBA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0051865	protein autoubiquitination	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0070534	protein K63-linked ubiquitination	IDA	biological process
GO:0035519	protein K29-linked ubiquitination	IDA	biological process
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0070585	protein localization to mitochondrion	IMP	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq