• Gene id: 54543

Gene Summary

• Gene Symbol: TOMM7   Gene   UCSC   Ensembl
• Aliases: TOM7
• Gene name: translocase of outer mitochondrial membrane 7
• Alternate names: mitochondrial import receptor subunit TOM7 homolog, translocase of outer membrane 7 kDa subunit homolog, translocase of outer mitochondrial membrane 7 homolog,
• Gene location: 7p15.3 (22822848: 22812631)     Exons: 24     NC_000007.14
• Gene summary(Entrez): This gene encodes a subunit of the translocase of the outer mitochondrial membrane. The encoded protein regulates the assembly and stability of the translocase complex. [provided by RefSeq, Oct 2012]
• OMIM: 607980

Protein Summary

• Protein general information: Q9P0U1  
  • Name: Mitochondrial import receptor subunit TOM7 homolog (Translocase of outer membrane 7 kDa subunit homolog)
  • Length: 55  
  • Mass: 6248
• Sequence:

  MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG

• Structural information:
  • Interpro: IPR012621  
  • STRING: ENSP00000351214
• Other Databases: GeneCards:  TOMM7  Malacards:  TOMM7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005742	mitochondrial outer membrane translocase complex	TAS	cellular component
GO:0098779	positive regulation of mitophagy in response to mitochondrial depolarization	IMP	biological process
GO:1903955	positive regulation of protein targeting to mitochondrion	IMP	biological process
GO:0031647	regulation of protein stability	IMP	biological process
GO:0005742	mitochondrial outer membrane translocase complex	IEA	cellular component
GO:0030150	protein import into mitochondrial matrix	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0008320	protein transmembrane transporter activity	TAS	molecular function
GO:0005742	mitochondrial outer membrane translocase complex	IDA	cellular component
GO:0006626	protein targeting to mitochondrion	TAS	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04137	Mitophagy - animal

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq