• Gene id: 5454

Gene Summary

• Gene Symbol: POU3F2   Gene   UCSC   Ensembl
• Aliases: BRN2, N-Oct3, OCT7, OTF-7, OTF7, POUF3, brn-2, oct-7
• Gene name: POU class 3 homeobox 2
• Alternate names: POU domain, class 3, transcription factor 2, brain-2, brain-specific homeobox/POU domain protein 2, nervous system-specific octamer-binding transcription factor N-Oct-3, octamer-binding protein 7, octamer-binding transcription factor 7,
• Gene location: 6q16.1 (98834573: 98839457)     Exons: 1     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the POU-III class of neural transcription factors. The encoded protein is involved in neuronal differentiation and enhances the activation of corticotropin-releasing hormone regulated genes. Overexpression of this protein is
• OMIM: 600494

Protein Summary

• Protein general information: P20265  
  • Name: POU domain, class 3, transcription factor 2 (Brain specific homeobox/POU domain protein 2) (Brain 2) (Brn 2) (Nervous system specific octamer binding transcription factor N Oct 3) (Octamer binding protein 7) (Oct 7) (Octamer binding transcription factor 7
  • Length: 443  
  • Mass: 46893
  • Tissue specificity: Expressed specifically in the neuroectodermal cell lineage.
• Sequence:

  MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSHGGGGGGGG
  GGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHGPGALQQQHQQQQQQQQQQQQQQQQQQQQQR
  PPHLVHHAANHHPGPGAWRSAAAAAHLPPSMGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHA
  DHHPHPHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYG
  NVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLK
  CPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTPVQ

• Structural information:
  • Protein Domains: (262..33-)
    (/note="POU-specific-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00530"-)
  • Interpro: IPR009057  IPR017970  IPR001356  IPR010982  IPR013847   IPR000327  IPR016362  
  • Prosite: PS00027 PS50071 PS00035 PS00465 PS51179
  • CDD: cd00086
  • STRING: ENSP00000329170
• Other Databases: GeneCards:  POU3F2  Malacards:  POU3F2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	ISS	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	ISS	biological process
GO:0048666	neuron development	ISS	biological process
GO:0048665	neuron fate specification	ISS	biological process
GO:0048663	neuron fate commitment	ISS	biological process
GO:0030182	neuron differentiation	ISS	biological process
GO:0007399	nervous system development	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071310	cellular response to organic substance	IEA	biological process
GO:0050770	regulation of axonogenesis	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0040018	positive regulation of multicellular organism growth	IEA	biological process
GO:0021985	neurohypophysis development	IEA	biological process
GO:0021799	cerebral cortex radially oriented cell migration	IEA	biological process
GO:0014044	Schwann cell development	IEA	biological process
GO:0014002	astrocyte development	IEA	biological process
GO:0008544	epidermis development	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0048666	neuron development	IEA	biological process
GO:0048665	neuron fate specification	IEA	biological process
GO:0048663	neuron fate commitment	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045595	regulation of cell differentiation	IEA	biological process
GO:0030182	neuron differentiation	IEA	biological process
GO:0022011	myelination in peripheral nervous system	IEA	biological process
GO:0021979	hypothalamus cell differentiation	IEA	biological process
GO:0021869	forebrain ventricular zone progenitor cell division	IEA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0003677	DNA binding	ISS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881