• Gene id: 54536

Gene Summary

• Gene Symbol: EXOC6   Gene   UCSC   Ensembl
• Aliases: EXOC6A, SEC15, SEC15L, SEC15L1, SEC15L3, Sec15p
• Gene name: exocyst complex component 6
• Alternate names: exocyst complex component 6, SEC15-like 1, SEC15-like protein 3, exocyst complex component Sec15A, rsec15-like protein,
• Gene location: 10q23.33 (92826830: 93059493)     Exons: 27     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is highly similar to the Saccharomyces cerevisiae SEC15 gene product, which is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex re
• OMIM: 609672

Protein Summary

• Protein general information: Q8TAG9  
  • Name: Exocyst complex component 6 (Exocyst complex component Sec15A) (SEC15 like protein 1)
  • Length: 804  
  • Mass: 93722
• Sequence:

  MAENSESLGTVPEHERILQEIESTDTACVGPTLRSVYDDQPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVD
  AITELLKVRTDAEKLKVQVTDTNRRFQDAGKEVIVHTEDIIRCRIQQRNITTVVEKLQLCLPVLEMYSKLKEQMS
  AKRYYSALKTMEQLENVYFPWVSQYRFCQLMIENLPKLREDIKEISMSDLKDFLESIRKHSDKIGETAMKQAQHQ
  KTFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEEDENEEEILTVQDLVDFSPVYRCLHIYSVLGDEE
  TFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFTQIVGFFVVEDHILHVTQGLVTRAYTDELWNMALSKIIAV
  LRAHSSYCTDPDLVLELKNLTVIFADTLQGYGFPVNRLFDLLFEIRDQYNETLLKKWAGVFRDIFEEDNYSPIPV
  VNEEEYKIVISKFPFQDPDLEKQSFPKKFPMSQSVPHIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLL
  TRTLSSCLLNLIRKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHTTRLYGLSTFKDARHAAEGE
  IYTKLNQKIDEFVQLADYDWTMSEPDGRASGYLMDLINFLRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLL
  DSELKQISMGAVQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPASKYLRV
  NPNTALTLLEKMKDTSKKNNIFAQFRKNDRDKQKLIETVVKQLRSLVNGMSQHM

• Structural information:
  • Interpro: IPR007225  IPR042045  IPR042044  
  • STRING: ENSP00000260762
• Other Databases: GeneCards:  EXOC6  Malacards:  EXOC6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006887	exocytosis	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0000145	exocyst	IBA	cellular component
GO:0006893	Golgi to plasma membrane transport	IBA	biological process
GO:0000145	exocyst	IEA	cellular component
GO:0006904	vesicle docking involved in exocytosis	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0006887	exocytosis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090543	Flemming body	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq