• Gene id: 54531

Gene Summary

• Gene Symbol: MIER2   Gene   UCSC   Ensembl
• Aliases: KIAA1193, Mi-er2
• Gene name: MIER family member 2
• Alternate names: mesoderm induction early response protein 2, mesoderm induction early response 1, family member 2,
• Gene location: 19p13.3 (344840: 305572)     Exons: 18     NC_000019.10

Protein Summary

• Protein general information: Q8N344  
  • Name: Mesoderm induction early response protein 2 (Mi er2)
  • Length: 545  
  • Mass: 59944
• Sequence:

  MAEASSLGRQSPRVVSCLEHSLCPGEPGLQTTAVVSMGSGDHQFNLAEILSQNYSVRGECEEASRCPDKPKEELE
  KDFISQSNDMPFDELLALYGYEASDPISDRESEGGDVAPNLPDMTLDKEQIAKDLLSGEEEEETQSSADDLTPSV
  TSHEASDLFPNRSGSRFLADEDREPGSSASSDTEEDSLPANKCKKEIMVGPQFQADLSNLHLNRHCEKIYENEDQ
  LLWDPSVLPEREVEEFLYRAVKRRWHEMAGPQLPEGEAVKDSEQALYELVKCNFNVEEALRRLRFNVKVIRDGLC
  AWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGECVEYYYLWKKSERYDYFAQQTRLGRRKYVPSGTTDADQD
  LDGSDPDGPGRPRPEQDTLTGMRTDPLSVDGTAGGLDEPGVASDGLPSSEPGPCSFQQLDESPAVPLSHRPPALA
  DPASYQPAVTAPEPDASPRLAVDFALPKELPLISSHVDLSGDPEETVAPAQVALSVTEFGLIGIGDVNPFLAAHP
  TCPAPGLHSEPLSHCNVMTC

• Structural information:
  • Protein Domains: (195..29-)
    (/note="ELM2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00512-)
    (297..34-)
    (/note="SANT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00624"-)
  • Interpro: IPR000949  IPR009057  IPR040138  IPR001005  IPR017884  
  • Prosite: PS51156 PS51293
  • STRING: ENSP00000264819
• Other Databases: GeneCards:  MIER2  Malacards:  MIER2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042826	histone deacetylase binding	IBA	molecular function
GO:0016575	histone deacetylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0001103	RNA polymerase II repressing transcription factor binding	IBA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016575	histone deacetylation	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0004407	histone deacetylase activity	IDA	contributes to
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq