About Us

Search Result


Gene id 54504
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol CPVL   Gene   UCSC   Ensembl
Aliases HVLP
Gene name carboxypeptidase vitellogenic like
Alternate names probable serine carboxypeptidase CPVL, CP-Mac carboxypeptidase, VCP-like protein, carboxypeptidase WUG, vitellogenic carboxypeptidase-like protein,
Gene location 7p14.3 (50611773: 50606453)     Exons: 4     NC_000003.12
Gene summary(Entrez) The protein encoded by this gene is a carboxypeptidase and bears strong sequence similarity to serine carboxypeptidases. Carboxypeptidases are a large class of proteases that act to cleave a single amino acid from the carboxy termini of proteins or peptid
OMIM 609780

Protein Summary

Protein general information Q9H3G5  

Name: Probable serine carboxypeptidase CPVL (EC 3.4.16. ) (Carboxypeptidase, vitellogenic like) (Vitellogenic carboxypeptidase like protein) (VCP like protein) (hVLP)

Length: 476  Mass: 54164

Tissue specificity: Expressed in macrophages but not in other leukocytes. Abundantly expressed in heart and kidney. Also expressed in spleen, leukocytes, and placenta.

Sequence MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGRELSLVGPFPGLNMKSYA
GFLTVNKTYNSNLFFWFFPAQIQPEDAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDFPWTTTLSMLY
IDNPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYVPAIAHLIHSLNPVRE
VKINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRKQNWFEAFEILDKLLDGDLTS
DPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLSLPEVRQAIHVGNQTFNDGTIVEKYLREDTVQSVKPWLTEIM
NNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWKIFKSDSEVAGYIRQAGDFHQVIIRGGGHIL
PYDQPLRAFDMINRFIYGKGWDPYVG
Structural information
Interpro:  IPR029058  IPR001563  IPR018202  
Prosite:   PS00131
STRING:   ENSP00000387164
Other Databases GeneCards:  CPVL  Malacards:  CPVL

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0004185 serine-type carboxypeptid
ase activity
IBA molecular function
GO:0051603 proteolysis involved in c
ellular protein catabolic
process
IBA biological process
GO:0004185 serine-type carboxypeptid
ase activity
IEA molecular function
GO:0006508 proteolysis
IEA biological process
GO:0006508 proteolysis
IEA biological process
GO:0004180 carboxypeptidase activity
IEA molecular function
GO:0008233 peptidase activity
IEA molecular function
GO:0016787 hydrolase activity
IEA molecular function
GO:0070062 extracellular exosome
HDA cellular component
GO:0070062 extracellular exosome
HDA cellular component
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract