• Gene id: 5450

Gene Summary

• Gene Symbol: POU2AF1   Gene   UCSC   Ensembl
• Aliases: BOB1, OBF-1, OBF1, OCAB
• Gene name: POU class 2 homeobox associating factor 1
• Alternate names: POU domain class 2-associating factor 1, B-cell-specific coactivator OBF-1, BOB-1, OCA-B, OCT-binding factor 1, POU class 2 associating factor 1,
• Gene location: 11q23.1 (111379670: 111352250)     Exons: 8     NC_000011.10
• OMIM: 300757

Protein Summary

• Protein general information: Q16633  
  • Name: POU domain class 2 associating factor 1 (B cell specific coactivator OBF 1) (BOB 1) (OCA B) (OCT binding factor 1)
  • Length: 256  
  • Mass: 27436
  • Tissue specificity: B-cell specific.
• Sequence:

  MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVS
  AVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITN
  VTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRR
  AASSLTIDKLLLEEEDSDAYALNHTLSVEGF

• Structural information:
  • Interpro: IPR015389  
  • PDB: 1CQT
  • PDBsum: 1CQT
  • STRING: ENSP00000376786
• Other Databases: GeneCards:  POU2AF1  Malacards:  POU2AF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090575	RNA polymerase II transcription regulator complex	IBA	cellular component
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding	IBA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0032755	positive regulation of interleukin-6 production	ISS	biological process
GO:0003713	transcription coactivator activity	ISS	molecular function
GO:0098586	cellular response to virus	ISS	biological process
GO:0002314	germinal center B cell differentiation	ISS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003712	transcription coregulator activity	TAS	molecular function
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0006959	humoral immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	molecular function
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding	IMP	molecular function
GO:0003713	transcription coactivator activity	IMP	molecular function
GO:0090575	RNA polymerase II transcription regulator complex	IMP	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0090575	RNA polymerase II transcription regulator complex	IDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R