• Gene id: 54496

Gene Summary

• Gene Symbol: PRMT7   Gene   UCSC   Ensembl
• Aliases: SBIDDS
• Gene name: protein arginine methyltransferase 7
• Alternate names: protein arginine N-methyltransferase 7, [Myelin basic protein]-arginine N-methyltransferase PRMT7, histone-arginine N-methyltransferase PRMT7,
• Gene location: 16q22.1 (68310981: 68360875)     Exons: 22     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the protein arginine N-methyltransferase family of proteins. The encoded enzyme transfers single methyl groups to arginine residues to generate monomethylarginines on histone proteins as well as other protein substrates. This
• OMIM: 618130

Protein Summary

• Protein general information: Q9NVM4  
  • Name: Protein arginine N methyltransferase 7 (EC 2.1.1.321) (Histone arginine N methyltransferase PRMT7) ([Myelin basic protein] arginine N methyltransferase PRMT7)
  • Length: 692  
  • Mass: 78459
• Sequence:

  MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQGIRAAVSRVKDRGQKALVLDIGTGT
  GLLSMMAVTAGADFCYAIEVFKPMADAAVKIVEKNGFSDKIKVINKHSTEVTVGPEGDMPCRANILVTELFDTEL
  IGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESGRMWSWNKLFPIHVQTSLGEQVIVPPVDVESCPGAPSV
  CDIQLNQVSPADFTVLSDVLPMFSIDFSKQVSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFW
  AHSDPEEMQWRDHWMQCVYFLPQEEPVVQGSALYLVAHHDDYCVWYSLQRTSPEKNERVRQMRPVCDCQAHLLWN
  RPRFGEINDQDRTDRYVQALRTVLKPDSVCLCVSDGSLLSVLAHHLGVEQVFTVESSAASHKLLRKIFKANHLED
  KINIIEKRPELLTNEDLQGRKVSLLLGEPFFTTSLLPWHNLYFWYVRTAVDQHLGPGAMVMPQAASLHAVVVEFR
  DLWRIRSPCGDCEGFDVHIMDDMIKRALDFRESREAEPHPLWEYPCRSLSEPWQILTFDFQQPVPLQPLCAEGTV
  ELRRPGQSHAAVLWMEYHLTPECTLSTGLLEPADPEGGCCWNPHCKQAVYFFSPAPDPRALLGGPRTVSYAVEFH
  PDTGDIIMEFRHADTPD

• Structural information:
  • Protein Domains: (14..34-)
    PRMT-type (/note="SAM-dependent-MTase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01015-)
    (358..68-)
    PRMT-type (/note="SAM-dependent-MTase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01015"-)
  • Interpro: IPR025799  IPR014644  IPR029063  
  • Prosite: PS51678
  • STRING: ENSP00000343103
• Other Databases: GeneCards:  PRMT7  Malacards:  PRMT7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043985	histone H4-R3 methylation	IEA	biological process
GO:0043985	histone H4-R3 methylation	IEA	biological process
GO:0035247	peptidyl-arginine omega-N-methylation	IEA	biological process
GO:0035247	peptidyl-arginine omega-N-methylation	IEA	biological process
GO:0035247	peptidyl-arginine omega-N-methylation	IEA	biological process
GO:0035247	peptidyl-arginine omega-N-methylation	IEA	biological process
GO:0035246	peptidyl-arginine N-methylation	IEA	biological process
GO:0035246	peptidyl-arginine N-methylation	IEA	biological process
GO:0019918	peptidyl-arginine methylation, to symmetrical-dimethyl arginine	IEA	biological process
GO:0019918	peptidyl-arginine methylation, to symmetrical-dimethyl arginine	IEA	biological process
GO:0019918	peptidyl-arginine methylation, to symmetrical-dimethyl arginine	IEA	biological process
GO:0019918	peptidyl-arginine methylation, to symmetrical-dimethyl arginine	IEA	biological process
GO:0035243	protein-arginine omega-N symmetric methyltransferase activity	IDA	molecular function
GO:0035241	protein-arginine omega-N monomethyltransferase activity	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0035243	protein-arginine omega-N symmetric methyltransferase activity	IMP	molecular function
GO:0018216	peptidyl-arginine methylation	IMP	biological process
GO:0000387	spliceosomal snRNP assembly	IMP	biological process
GO:0008469	histone-arginine N-methyltransferase activity	IDA	molecular function
GO:0016277	[myelin basic protein]-arginine N-methyltransferase activity	IDA	molecular function
GO:0035241	protein-arginine omega-N monomethyltransferase activity	IDA	molecular function
GO:0042393	histone binding	IC	molecular function
GO:0043393	regulation of protein binding	IC	biological process
GO:0008757	S-adenosylmethionine-dependent methyltransferase activity	IDA	molecular function
GO:0016571	histone methylation	IDA	biological process
GO:0035243	protein-arginine omega-N symmetric methyltransferase activity	IDA	molecular function
GO:0018216	peptidyl-arginine methylation	IDA	biological process
GO:0035241	protein-arginine omega-N monomethyltransferase activity	IBA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0032259	methylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0006479	protein methylation	IEA	biological process
GO:0016274	protein-arginine N-methyltransferase activity	IEA	molecular function
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0018216	peptidyl-arginine methylation	IEA	biological process
GO:0035241	protein-arginine omega-N monomethyltransferase activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043046	DNA methylation involved in gamete generation	IEA	biological process
GO:0044020	histone methyltransferase activity (H4-R3 specific)	IEA	molecular function
GO:0006349	regulation of gene expression by genetic imprinting	IEA	biological process
GO:0034969	histone arginine methylation	IEA	biological process
GO:0035243	protein-arginine omega-N symmetric methyltransferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0044020	histone methyltransferase activity (H4-R3 specific)	ISS	molecular function
GO:0043046	DNA methylation involved in gamete generation	ISS	biological process
GO:0043021	ribonucleoprotein complex binding	IPI	molecular function
GO:0034969	histone arginine methylation	ISS	biological process
GO:0006349	regulation of gene expression by genetic imprinting	ISS	biological process
GO:0001650	fibrillar center	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq