• Gene id: 54492

Gene Summary

• Gene Symbol: NEURL1B   Gene   UCSC   Ensembl
• Aliases: NEURL3, RNF67B, hNeur2, neur2
• Gene name: neuralized E3 ubiquitin protein ligase 1B
• Alternate names: E3 ubiquitin-protein ligase NEURL1B, E3 ubiquitin-protein ligase NEURL3, RING-type E3 ubiquitin transferase NEURL1B, neuralized 2 alternative protein, neuralized homolog 1B, neuralized-2, neuralized-like protein 1B, neuralized-like protein 3,
• Gene location: 5q35.1 (172641262: 172691539)     Exons: 5     NC_000005.10
• OMIM: 610087

Protein Summary

• Protein general information: A8MQ27  
  • Name: E3 ubiquitin protein ligase NEURL1B (EC 2.3.2.27) (Neuralized 2) (NEUR2) (Neuralized like protein 1B) (Neuralized like protein 3) (RING type E3 ubiquitin transferase NEURL1B)
  • Length: 555  
  • Mass: 59270
  • Tissue specificity: Highest expression in brain, prostate and small intestine. In the brain the levels are higher in fetal than in adult stage. In the adult brain the highest levels are detected in the olfactory system, cerebellar cortex, optic nerve and
• Sequence:

  MGNTVHRTLPDPSPPARLLATRPCCGPGPERRPVLGEAPRFHAQAKGKNVRLDGHSRRATRRNSFCNGVTFTQRP
  IRLYEQVRLRLVAVRPGWSGALRFGFTAHDPSLMSAQDIPKYACPDLVTRPGYWAKALPENLALRDTVLAYWADR
  HGRVFYSVNDGEPVLFHCGVAVGGPLWALIDVYGITDEVQLLESAFADTLTPARLSQARFSACLPPSSHDAANFD
  NNELENNQVVAKLGHLALGRAPGPPPADAAAAAIPCGPRERPRPASSPALLEADLRFHATRGPDVSLSADRKVAC
  APRPDGGRTLVFSERPLRPGESLFVEVGRPGLAAPGALAFGITSCDPGVLRPNELPADPDALLDRKEYWVVARAG
  PVPSGGDALSFTLRPGGDVLLGINGRPRGRLLCVDTTQALWAFFAVRGGVAGQLRLLGTLQSSPATTTPSGSLSG
  SQDDSDSDMTFSVNQSSSASESSLVTAPSSPLSPPVSPVFSPPEPAGIKNGECTVCFDGEVDTVIYTCGHMCLCH
  SCGLRLKRQARACCPICRRPIKDVIKIYRP

• Structural information:
  • Protein Domains: (38..19-)
    (/note="NHR-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00400-)
    (279..43-)
    (/note="NHR-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00400"-)
  • Interpro: IPR037962  IPR006573  IPR001841  IPR013083  
  • Prosite: PS51065 PS50089
  • STRING: ENSP00000358815
• Other Databases: GeneCards:  NEURL1B  Malacards:  NEURL1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0070086	ubiquitin-dependent endocytosis	IBA	biological process
GO:0005769	early endosome	IBA	cellular component
GO:0061630	ubiquitin protein ligase activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005769	early endosome	ISS	cellular component
GO:0070086	ubiquitin-dependent endocytosis	ISS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0005769	early endosome	IEA	cellular component
GO:0070086	ubiquitin-dependent endocytosis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq