• Gene id: 54491

Gene Summary

• Gene Symbol: OTULINL   Gene   UCSC   Ensembl
• Aliases: FAM105A, NET20
• Gene name: OTU deubiquitinase with linear linkage specificity like
• Alternate names: inactive ubiquitin thioesterase OTULINL, family with sequence similarity 105 member A, inactive ubiquitin thioesterase FAM105A, protein FAM105A,
• Gene location: 5p15.2 (14581791: 14616179)     Exons: 9     NC_000005.10

Protein Summary

• Protein general information: Q9NUU6  
  • Name: Inactive ubiquitin thioesterase OTULINL
  • Length: 356  
  • Mass: 42196
• Sequence:

  MAATRSPTRARERERSGAPAAGSDQVHSWMLATSQALDTVWRMAKGFVMLAVSFLVAAICYFRRLHLYSGHKLKW
  WIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEELFWRHHIKCVRQVRRDNYDALRSVLFQIFS
  QGISFPSWMKEKDIVKLPEKLLFSQGCNWIQQYSFGPEKYTGSNVFGKLRKYVELLKTQWTEFNGIRDYHKRGSM
  CNTLFSDAILEYKLYEALKFIMLYQVTEVYEQMKTKKVIPSLFRLLFSRETSSDPLSFMMNHLNSVGDTCGLEQI
  DMFILGYSLEVKIKVFRLFKFNSRDFEVCYPEEPLRDWPEISLLTENDRHYHIPVF

• Structural information:
  • Protein Domains: (128..35-)
    (/note="OTU-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00139"-)
  • Interpro: IPR023235  IPR023236  
  • PDB: 6DRM
  • PDBsum: 6DRM
  • STRING: ENSP00000274217
• Other Databases: GeneCards:  OTULINL  Malacards:  OTULINL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005635	nuclear envelope	IDA	colocalizes with
GO:0005737	cytoplasm	IDA	cellular component
GO:0042406	extrinsic component of endoplasmic reticulum membrane	IDA	cellular component
GO:0016579	protein deubiquitination	IDA	NOT|biological process
GO:0043130	ubiquitin binding	IDA	NOT|molecular function
GO:0019783	ubiquitin-like protein-specific protease activity	IDA	NOT|molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray