• Gene id: 54490

Gene Summary

• Gene Symbol: UGT2B28   Gene   UCSC   Ensembl
• Gene name: UDP glucuronosyltransferase family 2 member B28
• Alternate names: UDP-glucuronosyltransferase 2B28, UDP glucuronosyltransferase 2 family, polypeptide B28, UDP glycosyltransferase 2 family, polypeptide B28, UDPGT 2B28,
• Gene location: 4q13.2 (69280428: 69295049)     Exons: 6     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the uridine diphosphoglucuronosyltransferase protein family. The encoded enzyme catalyzes the transfer of glucuronic acid from uridine diphosphoglucuronic acid to a diverse array of substrates including steroid hormones and l
• OMIM: 606497

Protein Summary

• Protein general information: Q9BY64  
  • Name: UDP glucuronosyltransferase 2B28 (UDPGT 2B28) (EC 2.4.1.17)
  • Length: 529  
  • Mass: 60906
  • Tissue specificity: Expressed in the liver, breast and kidney. {ECO
• Sequence:

  MALKWTSVLLLIHLGCYFSSGSCGKVLVWTGEYSHWMNMKTILKELVQRGHEVTVLASSASILFDPNDAFTLKLE
  VYPTSLTKTEFENIIMQQVKRWSDIQKDSFWLYFSQEQEILWEFHDIFRNFCKDVVSNKKVMKKLQESRFDIIFA
  DAFFPCGELLAALLNIPFVYSLCFTPGYTIERHSGGLIFPPSYIPVVMSKLSDQMTFMERVKNMIYVLYFDFWFQ
  MCDMKKWDQFYSEVLGRPTTLFETMGKADIWLMRNSWSFQFPHPFLPNIDFVGGLHCKPAKPLPKEMEEFVQSSG
  ENGVVVFSLGSVISNMTAERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQNDLLGLPKTRAFITHG
  GANGIYEAIYHGIPMVGIPLFWDQPDNIAHMKAKGAAVRLDFHTMSSTDLLNALKTVINDPSYKENVMKLSIIQH
  DQPVKPLHRAVFWIEFVMCHKGAKHLRVAARDLTWFQYHSLDVIGFLLACVATVIFVVTKFCLFCFWKFARKGKK
  GKRD

• Structural information:
  • Interpro: IPR002213  IPR035595  
  • Prosite: PS00375
  • STRING: ENSP00000334276
• Other Databases: GeneCards:  UGT2B28  Malacards:  UGT2B28

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0008194	UDP-glycosyltransferase activity	IBA	molecular function
GO:0008194	UDP-glycosyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015020	glucuronosyltransferase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0052697	xenobiotic glucuronidation	IDA	biological process
GO:0008202	steroid metabolic process	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0015020	glucuronosyltransferase activity	IDA	molecular function
GO:0005640	nuclear outer membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00983	Drug metabolism - other enzymes
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa00830	Retinol metabolism
hsa00140	Steroid hormone biosynthesis
hsa00860	Porphyrin and chlorophyll metabolism
hsa00040	Pentose and glucuronate interconversions
hsa00053	Ascorbate and aldarate metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)