• Gene id: 54469

Gene Summary

• Gene Symbol: ZFAND6   Gene   UCSC   Ensembl
• Aliases: AWP1, ZA20D3, ZFAND5B
• Gene name: zinc finger AN1-type containing 6
• Alternate names: AN1-type zinc finger protein 6, protein associated with PRK1, zinc finger, A20 domain containing 3, zinc finger, AN1-type domain 6,
• Gene location: 15q25.1 (80059567: 80138392)     Exons: 18     NC_000015.10
• OMIM: 610183

Protein Summary

• Protein general information: Q6FIF0  
  • Name: AN1 type zinc finger protein 6 (Associated with PRK1 protein) (Zinc finger A20 domain containing protein 3)
  • Length: 208  
  • Mass: 22555
  • Tissue specificity: Widely expressed with high level in heart, skeletal muscle, liver, kidney and placenta. {ECO
• Sequence:

  MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPVQCTDGSVPEAQ
  SALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDKAVPETEDVQASVSDTAQQPSEEQSKSLEKPKQKKNRCF
  MCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI

• Structural information:
  • Interpro: IPR035896  IPR002653  IPR000058  
  • Prosite: PS51036 PS51039
  • STRING: ENSP00000261749
• Other Databases: GeneCards:  ZFAND6  Malacards:  ZFAND6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031593	polyubiquitin modification-dependent protein binding	IBA	molecular function
GO:0006625	protein targeting to peroxisome	IBA	biological process
GO:0071356	cellular response to tumor necrosis factor	IMP	biological process
GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0031593	polyubiquitin modification-dependent protein binding	ISS	molecular function
GO:0006625	protein targeting to peroxisome	ISS	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006625	protein targeting to peroxisome	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006625	protein targeting to peroxisome	IEA	biological process
GO:0031593	polyubiquitin modification-dependent protein binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0043066	negative regulation of apoptotic process	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq