• Gene id: 54460

Gene Summary

• Gene Symbol: MRPS21   Gene   UCSC   Ensembl
• Aliases: MDS016, MRP-S21, RPMS21
• Gene name: mitochondrial ribosomal protein S21
• Alternate names: 28S ribosomal protein S21, mitochondrial, S21mt, mitochondrial 28S ribosomal protein S21, mitochondrial small ribosomal subunit protein bS21m,
• Gene location: 1q21.2 (69093992: 69131068)     Exons: 16     NC_000005.10
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611984

Protein Summary

• Protein general information: P82921  
  • Name: 28S ribosomal protein S21, mitochondrial (MRP S21) (S21mt) (Mitochondrial small ribosomal subunit protein bS21m)
  • Length: 87  
  • Mass: 10689
• Sequence:

  MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCCRRQRESYERCRRIYNMEMARKINFL
  MRKNRADPWQGC

• Structural information:
  • Interpro: IPR001911  IPR038380  
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • STRING: ENSP00000461930
• Other Databases: GeneCards:  MRPS21  Malacards:  MRPS21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005763	mitochondrial small ribosomal subunit	IDA	cellular component
GO:0003735	structural constituent of ribosome	NAS	molecular function
GO:0006412	translation	NAS	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0032543	mitochondrial translation	ISS	biological process
GO:0003735	structural constituent of ribosome	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)