• Gene id: 54434

Gene Summary

• Gene Symbol: SSH1   Gene   UCSC   Ensembl
• Aliases: SSH1L
• Gene name: slingshot protein phosphatase 1
• Alternate names: protein phosphatase Slingshot homolog 1, SSH-like protein 1, hSSH-1L, slingshot homolog 1,
• Gene location: 12q24.11 (108857605: 108778190)     Exons: 20     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the slingshot homolog (SSH) family of phosphatases, which regulate actin filament dynamics. The SSH proteins dephosphorylate and activate the actin binding/depolymerizing factor cofilin, which subsequently binds
• OMIM: 609977

Protein Summary

• Protein general information: Q8WYL5  
  • Name: Protein phosphatase Slingshot homolog 1 (EC 3.1.3.16) (EC 3.1.3.48) (SSH like protein 1) (SSH 1L) (hSSH 1L)
  • Length: 1049  
  • Mass: 115511
• Sequence:

  MALVTLQRSPTPSAASSSASNSELEAGSEEDRKLNLSLSESFFMVKGAALFLQQGSSPQGQRSLQHPHKHAGDLP
  QHLQVMINLLRCEDRIKLAVRLESAWADRVRYMVVVYSSGRQDTEENILLGVDFSSKESKSCTIGMVLRLWSDTK
  IHLDGDGGFSVSTAGRMHIFKPVSVQAMWSALQVLHKACEVARRHNYFPGGVALIWATYYESCISSEQSCINEWN
  AMQDLESTRPDSPALFVDKPTEGERTERLIKAKLRSIMMSQDLENVTSKEIRNELEKQMNCNLKELKEFIDNEML
  LILGQMDKPSLIFDHLYLGSEWNASNLEELQGSGVDYILNVTREIDNFFPGLFAYHNIRVYDEETTDLLAHWNEA
  YHFINKAKRNHSKCLVHCKMGVSRSASTVIAYAMKEFGWPLEKAYNYVKQKRSITRPNAGFMRQLSEYEGILDAS
  KQRHNKLWRQQTDSSLQQPVDDPAGPGDFLPETPDGTPESQLPFLDDAAQPGLGPPLPCCFRRLSDPLLPSPEDE
  TGSLVHLEDPEREALLEEAAPPAEVHRPARQPQQGSGLCEKDVKKKLEFGSPKGRSGSLLQVEETEREEGLGAGR
  WGQLPTQLDQNLLNSENLNNNSKRSCPNGMEDDAIFGILNKVKPSYKSCADCMYPTASGAPEASRERCEDPNAPA
  ICTQPAFLPHITSSPVAHLASRSRVPEKPASGPTEPPPFLPPAGSRRADTSGPGAGAALEPPASLLEPSRETPKV
  LPKSLLLKNSHCDKNPPSTEVVIKEESSPKKDMKPAKDLRLLFSNESEKPTTNSYLMQHQESIIQLQKAGLVRKH
  TKELERLKSVPADPAPPSRDGPASRLEASIPEESQDPAALHELGPLVMPSQAGSDEKSEAAPASLEGGSLKSPPP
  FFYRLDHTSSFSKDFLKTICYTPTSSSMSSNLTRSSSSDSIHSVRGKPGLVKQRTQEIETRLRLAGLTVSSPLKR
  SHSLAKLGSLTFSTEDLSSEADPSTVADSQDTTLSESSFLHEPQGTPRDPAATSKPSGKPAPENLKSPSWMSKS

• Structural information:
  • Protein Domains: (308..44-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR014876  IPR000340  IPR029021  IPR027233  IPR016130   IPR000387  IPR020422  
  • Prosite: PS00383 PS50056 PS50054
  • STRING: ENSP00000315713
• Other Databases: GeneCards:  SSH1  Malacards:  SSH1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003779	actin binding	IBA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IBA	molecular function
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0030837	negative regulation of actin filament polymerization	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0071318	cellular response to ATP	IDA	biological process
GO:0032268	regulation of cellular protein metabolic process	IDA	biological process
GO:0004721	phosphoprotein phosphatase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000463	positive regulation of excitatory postsynaptic potential	IEA	biological process
GO:1904754	positive regulation of vascular associated smooth muscle cell migration	IEA	biological process
GO:1904719	positive regulation of AMPA glutamate receptor clustering	IEA	biological process
GO:0098976	excitatory chemical synaptic transmission	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0031915	positive regulation of synaptic plasticity	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:1901216	positive regulation of neuron death	IEA	biological process
GO:0031252	cell leading edge	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0032154	cleavage furrow	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IDA	molecular function
GO:0003779	actin binding	IDA	molecular function
GO:0030036	actin cytoskeleton organization	IMP	biological process
GO:0006470	protein dephosphorylation	IMP	biological process
GO:0006470	protein dephosphorylation	IMP	biological process
GO:0000902	cell morphogenesis	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04810	Regulation of actin cytoskeleton
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray