• Gene id: 54431

Gene Summary

• Gene Symbol: DNAJC10   Gene   UCSC   Ensembl
• Aliases: ERdj5, JPDI, MTHr, PDIA19
• Gene name: DnaJ heat shock protein family (Hsp40) member C10
• Alternate names: dnaJ homolog subfamily C member 10, DnaJ (Hsp40) homolog, subfamily C, member 10, ER-resident protein ERdj5, J-domain-containing protein disulfide isomerase-like protein, endoplasmic reticulum DNA J domain-containing protein 5, macrothioredoxin, protein disulfi,
• Gene location: 2q32.1 (227871375: 227924346)     Exons: 16     NC_000002.12
• Gene summary(Entrez): This gene encodes an endoplasmic reticulum co-chaperone which is part of the endoplasmic reticulum-associated degradation complex involved in recognizing and degrading misfolded proteins. The encoded protein reduces incorrect disulfide bonds in misfolded
• OMIM: 607987

Protein Summary

• Protein general information: Q8IXB1  
  • Name: DnaJ homolog subfamily C member 10 (EC 1.8.4. ) (Endoplasmic reticulum DNA J domain containing protein 5) (ER resident protein ERdj5) (ERdj5) (Macrothioredoxin) (MTHr)
  • Length: 793  
  • Mass: 91080
• Sequence:

  MGVWLNKDDYIRDLKRIILCFLIVYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHG
  DFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWNYYRYDFGIYDDDPEIITLERREFDAAVNSGELWF
  VNFYSPGCSHCHDLAPTWRDFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESL
  VSFAMQHVRSTVTELWTGNFVNSIQTAFAAGIGWLITFCSKGGDCLTSQTRLRLSGMLDGLVNVGWMDCATQDNL
  CKSLDITTSTTAYFPPGATLNNKEKNSILFLNSLDAKEIYLEVIHNLPDFELLSANTLEDRLAHHRWLLFFHFGK
  NENSNDPELKKLKTLLKNDHIQVGRFDCSSAPDICSNLYVFQPSLAVFKGQGTKEYEIHHGKKILYDILAFAKES
  VNSHVTTLGPQNFPANDKEPWLVDFFAPWCPPCRALLPELRRASNLLYGQLKFGTLDCTVHEGLCNMYNIQAYPT
  TVVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKR
  MARTLTGLINVGSIDCQQYHSFCAQENVQRYPEIRFFPPKSNKAYHYHSYNGWNRDAYSLRIWGLGFLPQVSTDL
  TPQTFSEKVLQGKNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYF
  YERAKRNFQEEQINTRDAKAIAALISEKLETLRNQGKRNKDEL

• Structural information:
  • Protein Domains: (35..10-)
    (/note="J-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00286-)
    (130..23-)
    (/note="Thioredoxin-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00691-)
    (454..55-)
    (/note="Thioredoxin-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU-)
  • Interpro: IPR001623  IPR021170  IPR035674  IPR035673  IPR036869   IPR036249  IPR017937  IPR013766  
  • Prosite: PS50076 PS00014 PS00194 PS51352
  • CDD: cd06257 cd03004 cd03003
  • DIP: 48947
  • STRING: ENSP00000264065
• Other Databases: GeneCards:  DNAJC10  Malacards:  DNAJC10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015035	protein disulfide oxidoreductase activity	IDA	molecular function
GO:0005788	endoplasmic reticulum lumen	IDA	cellular component
GO:0034975	protein folding in endoplasmic reticulum	IDA	biological process
GO:0016671	oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor	ISS	molecular function
GO:0015035	protein disulfide oxidoreductase activity	ISS	molecular function
GO:0030544	Hsp70 protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0015036	disulfide oxidoreductase activity	IEA	molecular function
GO:0034975	protein folding in endoplasmic reticulum	IEA	biological process
GO:0045454	cell redox homeostasis	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051117	ATPase binding	IEA	molecular function
GO:0051087	chaperone binding	IEA	molecular function
GO:0032781	positive regulation of ATPase activity	IEA	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IEA	biological process
GO:0015036	disulfide oxidoreductase activity	IEA	molecular function
GO:0001671	ATPase activator activity	IEA	molecular function
GO:0016671	oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor	IEA	molecular function
GO:0015035	protein disulfide oxidoreductase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0034663	endoplasmic reticulum chaperone complex	IDA	cellular component
GO:0051087	chaperone binding	IDA	molecular function
GO:0034976	response to endoplasmic reticulum stress	IDA	biological process
GO:0051787	misfolded protein binding	IDA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0001933	negative regulation of protein phosphorylation	IDA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IDA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0032781	positive regulation of ATPase activity	ISS	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IMP	biological process
GO:0051117	ATPase binding	IPI	molecular function
GO:0015036	disulfide oxidoreductase activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001671	ATPase activator activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)