About Us

Search Result


Gene id 5441
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol POLR2L   Gene   UCSC   Ensembl
Aliases RBP10, RPABC5, RPB10, RPB10beta, RPB7.6, hRPB7.6
Gene name RNA polymerase II, I and III subunit L
Alternate names DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerase III subunit L, RNA polymerase II 7.6 kDa subunit, RNA polymerase II subunit L, RNA polymerases I, II, and III subunit ABC5, RPB10 homolog, polymerase (RNA) II (DNA directed),
Gene location 11p15.5 (842528: 839720)     Exons: 30     NC_000011.10
Gene summary(Entrez) This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains four conserved cysteines characteristic of an atypical zinc-binding domain. Like its counterpart i
OMIM 601189

Protein Summary

Protein general information P62875  

Name: DNA directed RNA polymerases I, II, and III subunit RPABC5 (RNA polymerases I, II, and III subunit ABC5) (DNA directed RNA polymerase III subunit L) (RNA polymerase II 7.6 kDa subunit) (RPB7.6) (RPB10 homolog)

Length: 67  Mass: 7645

Sequence MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Structural information
Interpro:  IPR023580  IPR020789  IPR000268  
Prosite:   PS01112

PDB:  
5IY6 5IY7 5IY8 5IY9 5IYA 5IYB 5IYC 5IYD 6DRD 6O9L
PDBsum:   5IY6 5IY7 5IY8 5IY9 5IYA 5IYB 5IYC 5IYD 6DRD 6O9L

DIP:  

32960

MINT:  
STRING:   ENSP00000324124
Other Databases GeneCards:  POLR2L  Malacards:  POLR2L

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0003899 DNA-directed 5'-3' RNA po
lymerase activity
IBA contributes to
GO:0005666 RNA polymerase III comple
x
IBA cellular component
GO:0005665 RNA polymerase II, core c
omplex
IBA cellular component
GO:0042797 tRNA transcription by RNA
polymerase III
IBA biological process
GO:0008270 zinc ion binding
IBA molecular function
GO:0006366 transcription by RNA poly
merase II
IBA biological process
GO:0006360 transcription by RNA poly
merase I
IBA biological process
GO:0005736 RNA polymerase I complex
IBA cellular component
GO:0006366 transcription by RNA poly
merase II
IDA biological process
GO:0005665 RNA polymerase II, core c
omplex
IDA cellular component
GO:0005634 nucleus
IDA cellular component
GO:0008270 zinc ion binding
IEA molecular function
GO:0003677 DNA binding
IEA molecular function
GO:0003899 DNA-directed 5'-3' RNA po
lymerase activity
IEA molecular function
GO:0006351 transcription, DNA-templa
ted
IEA biological process
GO:0046872 metal ion binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0003899 DNA-directed 5'-3' RNA po
lymerase activity
IEA molecular function
GO:0003899 DNA-directed 5'-3' RNA po
lymerase activity
TAS molecular function
GO:0006356 regulation of transcripti
on by RNA polymerase I
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0032481 positive regulation of ty
pe I interferon productio
n
TAS biological process
GO:0035019 somatic stem cell populat
ion maintenance
TAS biological process
GO:0050434 positive regulation of vi
ral transcription
TAS biological process
GO:0060964 regulation of gene silenc
ing by miRNA
TAS biological process
GO:0006283 transcription-coupled nuc
leotide-excision repair
TAS biological process
GO:0006351 transcription, DNA-templa
ted
TAS biological process
GO:0006368 transcription elongation
from RNA polymerase II pr
omoter
TAS biological process
GO:0006368 transcription elongation
from RNA polymerase II pr
omoter
TAS biological process
GO:0006368 transcription elongation
from RNA polymerase II pr
omoter
TAS biological process
GO:0006368 transcription elongation
from RNA polymerase II pr
omoter
TAS biological process
GO:0006370 7-methylguanosine mRNA ca
pping
TAS biological process
GO:0016070 RNA metabolic process
TAS biological process
GO:0042795 snRNA transcription by RN
A polymerase II
TAS biological process
GO:0045815 positive regulation of ge
ne expression, epigenetic
TAS biological process
GO:0000398 mRNA splicing, via splice
osome
TAS biological process
GO:0000398 mRNA splicing, via splice
osome
TAS biological process
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0006361 transcription initiation
from RNA polymerase I pro
moter
TAS biological process
GO:0006361 transcription initiation
from RNA polymerase I pro
moter
TAS biological process
GO:0006362 transcription elongation
from RNA polymerase I pro
moter
TAS biological process
GO:0006363 termination of RNA polyme
rase I transcription
TAS biological process
GO:0006366 transcription by RNA poly
merase II
TAS biological process
GO:0006367 transcription initiation
from RNA polymerase II pr
omoter
TAS biological process
GO:0006367 transcription initiation
from RNA polymerase II pr
omoter
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005634 nucleus
IEA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05016Huntington disease
hsa04623Cytosolic DNA-sensing pathway
hsa03020RNA polymerase
Associated diseases References
Cryptorchidism MIK: 28606200
Male factor infertility MIK: 29961538
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
29961538 Male facto
r infertil
ity

318 (128 couple
s presenting wi
th OAT (MF) and
118 maternal a
ge-matched cont
rol (no MF) sub
jects undergoin
g infertility t
reatment, 72 su
rplus cryoprese
rved blastocyst
s)
Male infertility RNA-seq
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract