Male Infertility Database

Search Result

Gene id

5440

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

POLR2K Gene UCSC Ensembl

Aliases

ABC10-alpha, RPABC4, RPB10alpha, RPB12, RPB7.0, hRPB7.0, hsRPB10a

Gene name

RNA polymerase II, I and III subunit K

Alternate names

DNA-directed RNA polymerases I, II, and III subunit RPABC4, DNA directed RNA polymerases I, II, and III 7.0 kda polypeptide, DNA-directed RNA polymerase II subunit K, RNA polymerase II 7.0 kDa subunit, RNA polymerase II subunit K, RNA polymerases I, II, and II,

Gene location

8q22.2 (100150635: 100154002) Exons: 4 NC_000008.11

Gene summary(Entrez)

This gene encodes one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases. [provided by RefSeq, Jul 2008]

OMIM

606033

Protein Summary

Protein general information

P53803

Name: DNA directed RNA polymerases I, II, and III subunit RPABC4 (RNA polymerases I, II, and III subunit ABC4) (ABC10 alpha) (DNA directed RNA polymerase II subunit K) (RNA polymerase II 7.0 kDa subunit) (RPB7.0) (RPB10alpha)

Length: 58 Mass: 7004

Sequence

MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Structural information

Interpro:	IPR006591 IPR039747 IPR029040
PDB:	5IY6 5IY7 5IY8 5IY9 5IYA 5IYB 5IYC 5IYD 6DRD 6O9L
PDBsum:	5IY6 5IY7 5IY8 5IY9 5IYA 5IYB 5IYC 5IYD 6DRD 6O9L
DIP:	32968
STRING:	ENSP00000342889

Other Databases

GeneCards: POLR2K Malacards: POLR2K

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0005666	RNA polymerase III comple x	IBA	cellular component
GO:0005665	RNA polymerase II, core c omplex	IBA	cellular component
GO:0005736	RNA polymerase I complex	IBA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003899	DNA-directed 5'-3' RNA po lymerase activity	IEA	molecular function
GO:0006351	transcription, DNA-templa ted	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003899	DNA-directed 5'-3' RNA po lymerase activity	IEA	molecular function
GO:0008270	zinc ion binding	TAS	molecular function
GO:0006356	regulation of transcripti on by RNA polymerase I	TAS	biological process
GO:0006366	transcription by RNA poly merase II	TAS	biological process
GO:0006383	transcription by RNA poly merase III	TAS	biological process
GO:0006283	transcription-coupled nuc leotide-excision repair	TAS	biological process
GO:0006351	transcription, DNA-templa ted	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II pr omoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II pr omoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II pr omoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II pr omoter	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0032481	positive regulation of ty pe I interferon productio n	TAS	biological process
GO:0035019	somatic stem cell populat ion maintenance	TAS	biological process
GO:0050434	positive regulation of vi ral transcription	TAS	biological process
GO:0060964	regulation of gene silenc ing by miRNA	TAS	biological process
GO:0000398	mRNA splicing, via splice osome	TAS	biological process
GO:0000398	mRNA splicing, via splice osome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006361	transcription initiation from RNA polymerase I pro moter	TAS	biological process
GO:0006361	transcription initiation from RNA polymerase I pro moter	TAS	biological process
GO:0006362	transcription elongation from RNA polymerase I pro moter	TAS	biological process
GO:0006363	termination of RNA polyme rase I transcription	TAS	biological process
GO:0006366	transcription by RNA poly merase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological process
GO:0006370	7-methylguanosine mRNA ca pping	TAS	biological process
GO:0016070	RNA metabolic process	TAS	biological process
GO:0042795	snRNA transcription by RN A polymerase II	TAS	biological process
GO:0045815	positive regulation of ge ne expression, epigenetic	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0006366	transcription by RNA poly merase II	IDA	biological process
GO:0005665	RNA polymerase II, core c omplex	IDA	cellular component

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa05016	Huntington disease
hsa04623	Cytosolic DNA-sensing pathway
hsa03020	RNA polymerase

Diseases

Expand All | Collapse All

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia			19 (6 controls , 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
21674046	Aberrant C pGs in Low Motility Sperm			18	Male infertility	GSE26881	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All