• Gene id: 54361

Gene Summary

• Gene Symbol: WNT4   Gene   UCSC   Ensembl
• Aliases: SERKAL, WNT-4
• Gene name: Wnt family member 4
• Alternate names: protein Wnt-4, wingless-type MMTV integration site family, member 4,
• Gene location: 1p36.12 (22143980: 22117307)     Exons: 8     NC_000001.11
• Gene summary(Entrez): The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog
• OMIM: 603490

Protein Summary

• Protein general information: P56705  
  • Name: Protein Wnt 4
  • Length: 351  
  • Mass: 39052
• Sequence:

  MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVMDSVRRGAQLAI
  EECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGF
  QWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVP
  PFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS
  KAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR

• Structural information:
  • Interpro: IPR005817  IPR009142  IPR018161  
  • Prosite: PS00246
  • STRING: ENSP00000290167
• Other Databases: GeneCards:  WNT4  Malacards:  WNT4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0045165	cell fate commitment	IBA	biological process
GO:0005109	frizzled binding	IBA	molecular function
GO:0030182	neuron differentiation	IBA	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0070062	extracellular exosome	TAS	cellular component
GO:0072273	metanephric nephron morphogenesis	IEA	biological process
GO:0072034	renal vesicle induction	IEA	biological process
GO:0072033	renal vesicle formation	IEA	biological process
GO:0060748	tertiary branching involved in mammary gland duct morphogenesis	IEA	biological process
GO:0060231	mesenchymal to epithelial transition	IEA	biological process
GO:0051496	positive regulation of stress fiber assembly	IEA	biological process
GO:0048754	branching morphogenesis of an epithelial tube	IEA	biological process
GO:0048599	oocyte development	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0045596	negative regulation of cell differentiation	IEA	biological process
GO:0045165	cell fate commitment	IEA	biological process
GO:0035567	non-canonical Wnt signaling pathway	IEA	biological process
GO:0035239	tube morphogenesis	IEA	biological process
GO:0033080	immature T cell proliferation in thymus	IEA	biological process
GO:0031012	extracellular matrix	IEA	cellular component
GO:0030336	negative regulation of cell migration	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0022407	regulation of cell-cell adhesion	IEA	biological process
GO:0008585	female gonad development	IEA	biological process
GO:0007276	gamete generation	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0001823	mesonephros development	IEA	biological process
GO:0001656	metanephros development	IEA	biological process
GO:2001234	negative regulation of apoptotic signaling pathway	IEA	biological process
GO:2000225	negative regulation of testosterone biosynthetic process	IEA	biological process
GO:0072210	metanephric nephron development	IEA	biological process
GO:0072174	metanephric tubule formation	IEA	biological process
GO:0072164	mesonephric tubule development	IEA	biological process
GO:0072006	nephron development	IEA	biological process
GO:0061205	paramesonephric duct development	IEA	biological process
GO:0061045	negative regulation of wound healing	IEA	biological process
GO:0060993	kidney morphogenesis	IEA	biological process
GO:0060129	thyroid-stimulating hormone-secreting cell differentiation	IEA	biological process
GO:0060126	somatotropin secreting cell differentiation	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0051894	positive regulation of focal adhesion assembly	IEA	biological process
GO:0051145	smooth muscle cell differentiation	IEA	biological process
GO:0048856	anatomical structure development	IEA	biological process
GO:0045836	positive regulation of meiotic nuclear division	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0042445	hormone metabolic process	IEA	biological process
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0033077	T cell differentiation in thymus	IEA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0009267	cellular response to starvation	IEA	biological process
GO:0008584	male gonad development	IEA	biological process
GO:0007548	sex differentiation	IEA	biological process
GO:0005109	frizzled binding	IEA	molecular function
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0001838	embryonic epithelial tube formation	IEA	biological process
GO:0001658	branching involved in ureteric bud morphogenesis	IEA	biological process
GO:0048018	receptor ligand activity	IDA	molecular function
GO:0030501	positive regulation of bone mineralization	IDA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IDA	biological process
GO:0061184	positive regulation of dermatome development	IDA	biological process
GO:0032967	positive regulation of collagen biosynthetic process	IDA	biological process
GO:0038030	non-canonical Wnt signaling pathway via MAPK cascade	IDA	biological process
GO:0032349	positive regulation of aldosterone biosynthetic process	IDA	biological process
GO:0010894	negative regulation of steroid biosynthetic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:2000180	negative regulation of androgen biosynthetic process	IDA	biological process
GO:2000066	positive regulation of cortisol biosynthetic process	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0010894	negative regulation of steroid biosynthetic process	IDA	biological process
GO:0010629	negative regulation of gene expression	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0072162	metanephric mesenchymal cell differentiation	NAS	biological process
GO:0061180	mammary gland epithelium development	IEP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0030325	adrenal gland development	IEP	biological process
GO:0001822	kidney development	IEP	biological process
GO:2000225	negative regulation of testosterone biosynthetic process	IMP	biological process
GO:2000019	negative regulation of male gonad development	IMP	biological process
GO:0009986	cell surface	ISS	cellular component
GO:0001889	liver development	IEP	biological process
GO:0001837	epithelial to mesenchymal transition	IEP	biological process
GO:0061369	negative regulation of testicular blood vessel morphogenesis	IMP	biological process
GO:0061205	paramesonephric duct development	IMP	biological process
GO:0008584	male gonad development	IMP	biological process
GO:0008584	male gonad development	IEP	biological process
GO:0003714	transcription corepressor activity	ISS	molecular function
GO:0071560	cellular response to transforming growth factor beta stimulus	IEP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0030237	female sex determination	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa04360	Axon guidance
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04919	Thyroid hormone signaling pathway
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Mullerian agenesis	KEGG:H00600
SERKAL syndrome	KEGG:H02317
Mullerian agenesis	KEGG:H00600
SERKAL syndrome	KEGG:H02317
Endometrial carcinoma	PMID:9099960
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq