• Gene id: 54360

Gene Summary

• Gene Symbol: CYTL1   Gene   UCSC   Ensembl
• Aliases: C17, C4orf4
• Gene name: cytokine like 1
• Alternate names: cytokine-like protein 1, cytokine-like protein C17,
• Gene location: 4p16.2 (48521807: 48528715)     Exons: 5     NC_000023.11
• Gene summary(Entrez): C17 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 (MIM 142230) surface marker (Liu et al., 2000 [PubMed 10857752]).[supplied by OMIM, Mar 2008]
• OMIM: 607930

Protein Summary

• Protein general information: Q9NRR1  
  • Name: Cytokine like protein 1 (Protein C17)
  • Length: 136  
  • Mass: 15577
  • Tissue specificity: Specifically expressed in CD34+ hematopoietic cells. {ECO
• Sequence:

  MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLR
  DFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

• Structural information:
  • Interpro: IPR029253  
  • STRING: ENSP00000303550
• Other Databases: GeneCards:  CYTL1  Malacards:  CYTL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:1990079	cartilage homeostasis	IEA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0048839	inner ear development	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0002062	chondrocyte differentiation	IEA	biological process
GO:0050650	chondroitin sulfate proteoglycan biosynthetic process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881