About Us

Search Result


Gene id 5435
Gene Summary     SNPs    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol POLR2F   Gene   UCSC   Ensembl
Aliases HRBP14.4, POLRF, RPABC14.4, RPABC2, RPB14.4, RPB6, RPC15
Gene name RNA polymerase II, I and III subunit F
Alternate names DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerase II subunit F, DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide, RNA Polymerase II subunit 14.4 kD, RNA polymerase II subunit F, RNA polymerases I, II, and I,
Gene location 22q13.1 (38831793: 38815421)     Exons: 9     NC_000019.10
Gene summary(Entrez) This gene encodes the sixth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit, in combination with at least two other subunits, forms a structure that stabilize
OMIM 604414

SNPs


rs139884

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.37973969A>G
NC_000022.10   g.38369976A>G
NG_007948.1   g.15564T>C
NM_006941.4   c.927T>C
NM_006941.3   c.927T>C|SEQ=[A/G]|GENE=POLR2F
SOX10   6663

Protein Summary

Protein general information P61218  

Name: DNA directed RNA polymerases I, II, and III subunit RPABC2 (RNA polymerases I, II, and III subunit ABC2) (DNA directed RNA polymerase II subunit F) (DNA directed RNA polymerases I, II, and III 14.4 kDa polypeptide) (RPABC14.4) (RPB14.4) (RPB6 homolog) (RP

Length: 127  Mass: 14478

Sequence MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAM
CAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
Structural information
Interpro:  IPR020708  IPR006110  IPR012293  IPR028363  IPR036161  
IPR006111  
Prosite:   PS01111

PDB:  
1QKL 5IY6 5IY7 5IY8 5IY9 5IYA 5IYB 5IYC 5IYD 6DRD 6O9L
PDBsum:   1QKL 5IY6 5IY7 5IY8 5IY9 5IYA 5IYB 5IYC 5IYD 6DRD 6O9L

DIP:  

32915

STRING:   ENSP00000403852
Other Databases GeneCards:  POLR2F  Malacards:  POLR2F

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0003899 DNA-directed 5'-3' RNA po
lymerase activity
IBA contributes to
GO:0005666 RNA polymerase III comple
x
IBA cellular component
GO:0005665 RNA polymerase II, core c
omplex
IBA cellular component
GO:0005736 RNA polymerase I complex
IBA cellular component
GO:0006366 transcription by RNA poly
merase II
IDA biological process
GO:0005665 RNA polymerase II, core c
omplex
IDA cellular component
GO:0005634 nucleus
IDA cellular component
GO:0005665 RNA polymerase II, core c
omplex
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0003899 DNA-directed 5'-3' RNA po
lymerase activity
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0006351 transcription, DNA-templa
ted
IEA biological process
GO:0005634 nucleus
IEA cellular component
GO:0003899 DNA-directed 5'-3' RNA po
lymerase activity
IEA molecular function
GO:0006283 transcription-coupled nuc
leotide-excision repair
TAS biological process
GO:0006351 transcription, DNA-templa
ted
TAS biological process
GO:0006368 transcription elongation
from RNA polymerase II pr
omoter
TAS biological process
GO:0006368 transcription elongation
from RNA polymerase II pr
omoter
TAS biological process
GO:0006368 transcription elongation
from RNA polymerase II pr
omoter
TAS biological process
GO:0006368 transcription elongation
from RNA polymerase II pr
omoter
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0032481 positive regulation of ty
pe I interferon productio
n
TAS biological process
GO:0035019 somatic stem cell populat
ion maintenance
TAS biological process
GO:0050434 positive regulation of vi
ral transcription
TAS biological process
GO:0060964 regulation of gene silenc
ing by miRNA
TAS biological process
GO:0000398 mRNA splicing, via splice
osome
TAS biological process
GO:0000398 mRNA splicing, via splice
osome
TAS biological process
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0006361 transcription initiation
from RNA polymerase I pro
moter
TAS biological process
GO:0006361 transcription initiation
from RNA polymerase I pro
moter
TAS biological process
GO:0006362 transcription elongation
from RNA polymerase I pro
moter
TAS biological process
GO:0006363 termination of RNA polyme
rase I transcription
TAS biological process
GO:0006366 transcription by RNA poly
merase II
TAS biological process
GO:0006367 transcription initiation
from RNA polymerase II pr
omoter
TAS biological process
GO:0006367 transcription initiation
from RNA polymerase II pr
omoter
TAS biological process
GO:0006370 7-methylguanosine mRNA ca
pping
TAS biological process
GO:0016070 RNA metabolic process
TAS biological process
GO:0042795 snRNA transcription by RN
A polymerase II
TAS biological process
GO:0045815 positive regulation of ge
ne expression, epigenetic
TAS biological process
GO:0005634 nucleus
IEA cellular component
GO:0001650 fibrillar center
IDA cellular component
GO:0005654 nucleoplasm
IDA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05016Huntington disease
hsa04623Cytosolic DNA-sensing pathway
hsa03020RNA polymerase
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract