Male Infertility Database

Search Result

Gene id

54346

Gene Summary Protein Summary Gene ontology Diseases PubMed

Gene Summary

Gene Symbol

UNC93A Gene UCSC Ensembl

Aliases

Unc-93A, dJ366N23.1, dJ366N23.2

Gene name

unc-93 homolog A

Alternate names

protein unc-93 homolog A, dJ366N23.1 (putative C. elegans UNC-93 (protein 1, C46F11.1) LIKE), dJ366N23.2 (putative C. elegans UNC-93 (protein 1, C46F11.1) C-terminal LIKE), unc93 homolog A,

Gene location

6q27 (167269031: 167316013) Exons: 13 NC_000006.12

OMIM

610969

Protein Summary

Protein general information

Q86WB7

Name: Protein unc 93 homolog A (HmUnc 93A) (Unc 93A)

Length: 457 Mass: 50270

Tissue specificity: Expressed in testis, small intestine, spleen, prostate and ovary. {ECO

Sequence

MDRSLRNVLVVSFGFLLLFTAYGGLQSLQSSLYSEEGLGVTALSTLYGGMLLSSMFLPPLLIERLGCKGTIILSM
CGYVAFSVGNFFASWYTLIPTSILLGLGAAPLWSAQCTYLTITGNTHAEKAGKRGKDMVNQYFGIFFLIFQSSGV
WGNLISSLVFGQTPSQETLPEEQLTSCGASDCLMATTTTNSTQRPSQQLVYTLLGIYTGSGVLAVLMIAAFLQPI
RDVQRESEGEKKSVPFWSTLLSTFKLYRDKRLCLLILLPLYSGLQQGFLSSEYTRSYVTCTLGIQFVGYVMICFS
ATDALCSVLYGKVSQYTGRAVLYVLGAVTHVSCMIALLLWRPRADHLAVFFVFSGLWGVADAVWQTQNNALYGVL
FEKSKEAAFANYRLWEALGFVIAFGYSMFLCVHVKLYILLGVLSLTMVAYGLVECVESKNPIRPHAPGQVNQAED
EEIQTKM

Structural information

Interpro:	IPR010291 IPR036259
STRING:	ENSP00000230256

Other Databases

GeneCards: UNC93A Malacards: UNC93A

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016021	integral component of mem brane	NAS	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Expand All | Collapse All

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

Expand All | Collapse All

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21674046	Aberrant C pGs in Low Motility Sperm			18	Male infertility	GSE26881	Show abstract
28606200	Cryptorchi dism			Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Diseases

Expand All | Collapse All