About Us

Search Result


Gene id 54331
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol GNG2   Gene   UCSC   Ensembl
Gene name G protein subunit gamma 2
Alternate names guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2, g gamma-I, guanine nucleotide binding protein (G protein), gamma 2, guanine nucleotide binding protein gamma 2, guanine nucleotide-binding protein G(I)/G(O) gamma-2 subunit,
Gene location 14q22.1 (51847130: 51969799)     Exons: 10     NC_000014.9
Gene summary(Entrez) This gene encodes one of the gamma subunits of a guanine nucleotide-binding protein. Such proteins are involved in signaling mechanisms across membranes. Various subunits forms heterodimers which then interact with the different signal molecules. [provide
OMIM 606981

Protein Summary

Protein general information P59768  

Name: Guanine nucleotide binding protein G(I)/G(S)/G(O) subunit gamma 2 (G gamma I)

Length: 71  Mass: 7850

Tissue specificity: Expressed in fetal tissues, including testis, adrenal gland, brain, white blood cells and brain. {ECO

Sequence MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL
Structural information
Interpro:  IPR015898  IPR036284  IPR001770  
Prosite:   PS50058
CDD:   cd00068

PDB:  
4KFM 5HE0 5HE1 5HE2 5HE3 5UKK 5UKL 5UKM 5UZ7 6B3J 6CRK 6D9H 6DDE 6DDF 6E3Y 6EG8 6G79 6GDG 6M8S 6N4B 6NI3 6NIY 6OIJ 6OIK 6ORV 6OS9 6OSA 6OT0
PDBsum:   4KFM 5HE0 5HE1 5HE2 5HE3 5UKK 5UKL 5UKM 5UZ7 6B3J 6CRK 6D9H 6DDE 6DDF 6E3Y 6EG8 6G79 6GDG 6M8S 6N4B 6NI3 6NIY 6OIJ 6OIK 6ORV 6OS9 6OSA 6OT0

DIP:  

33949

MINT:  
STRING:   ENSP00000334448
Other Databases GeneCards:  GNG2  Malacards:  GNG2

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0031681 G-protein beta-subunit bi
nding
IBA molecular function
GO:0005834 heterotrimeric G-protein
complex
IBA cellular component
GO:0007186 G protein-coupled recepto
r signaling pathway
IBA biological process
GO:0031680 G-protein beta/gamma-subu
nit complex
IBA cellular component
GO:0003924 GTPase activity
IEA molecular function
GO:0005834 heterotrimeric G-protein
complex
IEA cellular component
GO:0007186 G protein-coupled recepto
r signaling pathway
IEA biological process
GO:0007165 signal transduction
IEA biological process
GO:0005886 plasma membrane
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0007186 G protein-coupled recepto
r signaling pathway
TAS biological process
GO:0007223 Wnt signaling pathway, ca
lcium modulating pathway
TAS biological process
GO:0006457 protein folding
TAS biological process
GO:0030168 platelet activation
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0008283 cell population prolifera
tion
IEA biological process
GO:0007186 G protein-coupled recepto
r signaling pathway
IEA biological process
GO:0007191 adenylate cyclase-activat
ing dopamine receptor sig
naling pathway
ISS biological process
GO:0071380 cellular response to pros
taglandin E stimulus
ISS biological process
GO:0071870 cellular response to cate
cholamine stimulus
ISS biological process
GO:0005834 heterotrimeric G-protein
complex
ISS cellular component
GO:0016020 membrane
ISS cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0031681 G-protein beta-subunit bi
nding
IPI molecular function
GO:0070062 extracellular exosome
HDA cellular component
GO:0070062 extracellular exosome
HDA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05200Pathways in cancer
hsa04151PI3K-Akt signaling pathway
hsa04014Ras signaling pathway
hsa05163Human cytomegalovirus infection
hsa04062Chemokine signaling pathway
hsa05034Alcoholism
hsa05170Human immunodeficiency virus 1 infection
hsa05167Kaposi sarcoma-associated herpesvirus infection
hsa04723Retrograde endocannabinoid signaling
hsa04371Apelin signaling pathway
hsa04728Dopaminergic synapse
hsa04724Glutamatergic synapse
hsa04926Relaxin signaling pathway
hsa04725Cholinergic synapse
hsa04726Serotonergic synapse
hsa05032Morphine addiction
hsa04727GABAergic synapse
hsa04713Circadian entrainment
P06959CCKR signaling map
Associated diseases References
Cryptorchidism MIK: 28606200
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269
Unexplained infertility MIK: 25753583

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract
31037746 Spermatoge
nic defect
s

16 (1 control,
15 cases)
Male infertility GSE6023 analyzed using GEO2R
Show abstract
25753583 Unexplaine
d infertil
ity

46 (17 fertile
men, 29 male pa
tients)
Male infertility Microarray
Show abstract