Male Infertility Database

Search Result

Gene id

5433

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

POLR2D Gene UCSC Ensembl

Aliases

HSRBP4, HSRPB4, RBP4, RPB16, RPB4

Gene name

RNA polymerase II subunit D

Alternate names

DNA-directed RNA polymerase II subunit RPB4, DNA-directed RNA polymerase II 16 kDa polypeptide, DNA-directed RNA polymerase II subunit D, RNA polymerase II 16 kDa subunit, RNA polymerase II subunit B4, RNA polymerase II subunit hsRBP4, RNA polymerase II subunit,

Gene location

2q14.3 (45791953: 45811418) Exons: 14 NC_000020.11

Gene summary(Entrez)

This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have

OMIM

606017

Protein Summary

Protein general information

O15514

Name: DNA directed RNA polymerase II subunit RPB4 (RNA polymerase II subunit B4) (DNA directed RNA polymerase II subunit D) (RNA polymerase II 16 kDa subunit) (RPB16)

Length: 142 Mass: 16311

Sequence

MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFK
NRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY

Structural information

Interpro:	IPR010997 IPR006590 IPR005574 IPR038324
PDB:	2C35 5IY6 5IY7 5IY8 5IY9 5IYA 5IYB 5IYC 5IYD 6DRD 6O9L
PDBsum:	2C35 5IY6 5IY7 5IY8 5IY9 5IYA 5IYB 5IYC 5IYD 6DRD 6O9L
DIP:	32912
MINT:
STRING:	ENSP00000272645

Other Databases

GeneCards: POLR2D Malacards: POLR2D

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0005665	RNA polymerase II, core c omplex	IDA	cellular component
GO:0006366	transcription by RNA poly merase II	IMP	biological process
GO:0003899	DNA-directed 5'-3' RNA po lymerase activity	IMP	contributes to
GO:0006352	DNA-templated transcripti on, initiation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0030880	RNA polymerase complex	IEA	cellular component
GO:0044237	cellular metabolic proces s	IEA	biological process
GO:0031369	translation initiation fa ctor binding	IBA	molecular function
GO:0006367	transcription initiation from RNA polymerase II pr omoter	IBA	biological process
GO:0005665	RNA polymerase II, core c omplex	IBA	cellular component
GO:0000932	P-body	IBA	cellular component
GO:0000288	nuclear-transcribed mRNA catabolic process, deaden ylation-dependent decay	IBA	biological process
GO:0045948	positive regulation of tr anslational initiation	IBA	biological process
GO:0034402	recruitment of 3'-end pro cessing factors to RNA po lymerase II holoenzyme co mplex	IBA	biological process
GO:0031990	mRNA export from nucleus in response to heat stres s	IBA	biological process
GO:0003899	DNA-directed 5'-3' RNA po lymerase activity	IBA	contributes to
GO:0005634	nucleus	IEA	cellular component
GO:0003899	DNA-directed 5'-3' RNA po lymerase activity	IEA	molecular function
GO:0006283	transcription-coupled nuc leotide-excision repair	TAS	biological process
GO:0006351	transcription, DNA-templa ted	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II pr omoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II pr omoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II pr omoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II pr omoter	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0035019	somatic stem cell populat ion maintenance	TAS	biological process
GO:0050434	positive regulation of vi ral transcription	TAS	biological process
GO:0060964	regulation of gene silenc ing by miRNA	TAS	biological process
GO:0000398	mRNA splicing, via splice osome	TAS	biological process
GO:0000398	mRNA splicing, via splice osome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA poly merase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological process
GO:0006370	7-methylguanosine mRNA ca pping	TAS	biological process
GO:0016070	RNA metabolic process	TAS	biological process
GO:0042795	snRNA transcription by RN A polymerase II	TAS	biological process
GO:0006366	transcription by RNA poly merase II	IDA	biological process
GO:0005665	RNA polymerase II, core c omplex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa05016	Huntington disease
hsa03020	RNA polymerase

Diseases

Expand All | Collapse All

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia	13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
17327269	Teratozoos permia	19 (6 controls , 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
31037746	Spermatoge nic defect s	28 men with az oospermia	Male infertility	Microarray	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All