• Gene id: 54328

Gene Summary

• Gene Symbol: GPR173   Gene   UCSC   Ensembl
• Aliases: SREB3
• Gene name: G protein-coupled receptor 173
• Alternate names: probable G-protein coupled receptor 173, super conserved receptor expressed in brain 3,
• Gene location: Xp11.22 (53048788: 53080614)     Exons: 3     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the G-protein coupled receptor 1 family. This protein contains 7 transmembrane domains and conserved cysteine residues. [provided by RefSeq, Nov 2009]
• OMIM: 300253

Protein Summary

• Protein general information: Q9NS66  
  • Name: Probable G protein coupled receptor 173 (Super conserved receptor expressed in brain 3)
  • Length: 373  
  • Mass: 41481
  • Tissue specificity: Expressed in the ovary, specifically in granulosa cells of follicles that have passed the primary stage and in oocytes (at protein level) (PubMed
• Sequence:

  MANTTGEPEEVSGALSPPSASAYVKLVLLGLIMCVSLAGNAILSLLVLKERALHKAPYYFLLDLCLADGIRSAVC
  FPFVLASVRHGSSWTFSALSCKIVAFMAVLFCFHAAFMLFCISVTRYMAIAHHRFYAKRMTLWTCAAVICMAWTL
  SVAMAFPPVFDVGTYKFIREEDQCIFEHRYFKANDTLGFMLMLAVLMAATHAVYGKLLLFEYRHRKMKPVQMVPA
  ISQNWTFHGPGATGQAAANWIAGFGRGPMPPTLLGIRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWS
  PYIVACYWRVFVKACAVPHRYLATAVWMSFAQAAVNPIVCFLLNKDLKKCLRTHAPCWGTGGAPAPREPYCVM

• Structural information:
  • Interpro: IPR000276  IPR017452  
  • Prosite: PS50262
  • STRING: ENSP00000331600
• Other Databases: GeneCards:  GPR173  Malacards:  GPR173

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0004968	gonadotropin-releasing hormone receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:2001223	negative regulation of neuron migration	IEA	biological process
GO:0004968	gonadotropin-releasing hormone receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0097211	cellular response to gonadotropin-releasing hormone	IEA	biological process
GO:0097211	cellular response to gonadotropin-releasing hormone	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)