• Gene id: 54210

Gene Summary

• Gene Symbol: TREM1   Gene   UCSC   Ensembl
• Aliases: CD354, TREM-1
• Gene name: triggering receptor expressed on myeloid cells 1
• Alternate names: triggering receptor expressed on myeloid cells 1, triggering receptor expressed on monocytes 1,
• Gene location: 6p21.1 (41286744: 41267384)     Exons: 6     NC_000006.12
• Gene summary(Entrez): This gene encodes a receptor belonging to the Ig superfamily that is expressed on myeloid cells. This protein amplifies neutrophil and monocyte-mediated inflammatory responses triggered by bacterial and fungal infections by stimulating release of pro-infl
• OMIM: 605085

Protein Summary

• Protein general information: Q9NP99  
  • Name: Triggering receptor expressed on myeloid cells 1 (TREM 1) (Triggering receptor expressed on monocytes 1) (CD antigen CD354)
  • Length: 234  
  • Mass: 26387
  • Tissue specificity: Highly expressed in adult liver, lung and spleen than in corresponding fetal tissue. Also expressed in the lymph node, placenta, spinal cord and heart tissues. Expression is more elevated in peripheral blood leukocytes than in the bone
• Sequence:

  MRKTRLWGLLWMLFVSELRAATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSK
  NSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQN
  VYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFNIVILLAGGFLSKSLVFSVLF
  AVTLRSFVP

• Structural information:
  • Protein Domains: (26..13-)
    (/note="Ig-like-V-type")
  • Interpro: IPR036179  IPR013783  IPR003599  IPR013106  IPR039141  
  • PDB: 1Q8M 1SMO
  • PDBsum: 1Q8M 1SMO
  • STRING: ENSP00000244709
• Other Databases: GeneCards:  TREM1  Malacards:  TREM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0002526	acute inflammatory response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0006959	humoral immune response	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0045087	innate immune response	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0097110	scaffold protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)