• Gene id: 54206

Gene Summary

• Gene Symbol: ERRFI1   Gene   UCSC   Ensembl
• Aliases: GENE-33, MIG-6, MIG6, RALT
• Gene name: ERBB receptor feedback inhibitor 1
• Alternate names: ERBB receptor feedback inhibitor 1, mitogen-inducible gene 6 protein, receptor-associated late transducer,
• Gene location: 1p36.23 (8026308: 8011724)     Exons: 5     NC_000001.11
• Gene summary(Entrez): ERRFI1 is a cytoplasmic protein whose expression is upregulated with cell growth (Wick et al., 1995 [PubMed 7641805]). It shares significant homology with the protein product of rat gene-33, which is induced during cell stress and mediates cell signaling
• OMIM: 608069

Protein Summary

• Protein general information: Q9UJM3  
  • Name: ERBB receptor feedback inhibitor 1 (Mitogen inducible gene 6 protein) (MIG 6)
  • Length: 462  
  • Mass: 50560
• Sequence:

  MSIAGVAAQEIRVPLKTGFLHNGRAMGNMRKTYWSSRSEFKNNFLNIDPITMAYSLNSSAQERLIPLGHASKSAP
  MNGHCFAENGPSQKSSLPPLLIPPSENLGPHEEDQVVCGFKKLTVNGVCASTPPLTPIKNSPSLFPCAPLCERGS
  RPLPPLPISEALSLDDTDCEVEFLTSSDTDFLLEDSTLSDFKYDVPGRRSFRGCGQINYAYFDTPAVSAADLSYV
  SDQNGGVPDPNPPPPQTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDKPEVPPRVPIPPRPVKPDYRR
  WSAEVTSSTYSDEDRPPKVPPREPLSPSNSRTPSPKSLPSYLNGVMPPTQSFAPDPKYVSSKALQRQNSEGSASK
  VPCILPIIENGKKVSSTHYYLLPERPPYLDKYEKFFREAEETNGGAQIQPLPADCGISSATEKPDSKTKMDLGGH
  VKRKHLSYVVSP

• Structural information:
  • Interpro: IPR021619  
  • PDB: 2RF9 2RFD 2RFE 4I21 4R3P 4R3R 4ZJV
  • PDBsum: 2RF9 2RFD 2RFE 4I21 4R3P 4R3R 4ZJV
  • DIP: 42379
  • STRING: ENSP00000366702
• Other Databases: GeneCards:  ERRFI1  Malacards:  ERRFI1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045616	regulation of keratinocyte differentiation	IBA	biological process
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	IBA	biological process
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IBA	cellular component
GO:0031953	negative regulation of protein autophosphorylation	IDA	biological process
GO:0007175	negative regulation of epidermal growth factor-activated receptor activity	IDA	biological process
GO:0045616	regulation of keratinocyte differentiation	ISS	biological process
GO:0007175	negative regulation of epidermal growth factor-activated receptor activity	ISS	biological process
GO:0060428	lung epithelium development	ISS	biological process
GO:0060426	lung vasculature development	ISS	biological process
GO:0048286	lung alveolus development	ISS	biological process
GO:0043589	skin morphogenesis	ISS	biological process
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	ISS	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005737	cytoplasm	ISS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005096	GTPase activator activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007175	negative regulation of epidermal growth factor-activated receptor activity	IEA	biological process
GO:0045616	regulation of keratinocyte differentiation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0007175	negative regulation of epidermal growth factor-activated receptor activity	IEA	biological process
GO:0017124	SH3 domain binding	IEA	molecular function
GO:0032691	negative regulation of interleukin-1 beta production	IEA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0032966	negative regulation of collagen biosynthetic process	IEA	biological process
GO:0036120	cellular response to platelet-derived growth factor stimulus	IEA	biological process
GO:0061469	regulation of type B pancreatic cell proliferation	IEA	biological process
GO:0071474	cellular hyperosmotic response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IEA	cellular component
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	IEA	biological process
GO:0043589	skin morphogenesis	IEA	biological process
GO:0048286	lung alveolus development	IEA	biological process
GO:0060426	lung vasculature development	IEA	biological process
GO:0060428	lung epithelium development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0019900	kinase binding	IEA	molecular function
GO:0031267	small GTPase binding	IEA	molecular function
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	IEA	biological process
GO:0042536	negative regulation of tumor necrosis factor biosynthetic process	IEA	biological process
GO:0050732	negative regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0071364	cellular response to epidermal growth factor stimulus	IEA	biological process
GO:0071549	cellular response to dexamethasone stimulus	IEA	biological process
GO:1903243	negative regulation of cardiac muscle hypertrophy in response to stress	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq