• Gene id: 54205

Gene Summary

• Gene Symbol: CYCS   Gene   UCSC   Ensembl
• Aliases: CYC, HCS, THC4
• Gene name: cytochrome c, somatic
• Alternate names: cytochrome c,
• Gene location: 7p15.3 (25125360: 25118650)     Exons: 3     NC_000007.14
• Gene summary(Entrez): This gene encodes a small heme protein that functions as a central component of the electron transport chain in mitochondria. The encoded protein associates with the inner membrane of the mitochondrion where it accepts electrons from cytochrome b and tran
• OMIM: 123970

Protein Summary

• Protein general information: P99999  
  • Name: Cytochrome c
  • Length: 105  
  • Mass: 11,749
• Sequence:

  MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKY
  IPGTKMIFVGIKKKEERADLIAYLKKATNE

• Structural information:
  • Interpro: IPR009056  IPR036909  IPR002327  
  • Prosite: PS51007
  • PDB: 1J3S 2N3Y 2N9I 2N9J 3NWV 3ZCF 3ZOO 5EXQ 5TY3
  • PDBsum: 1J3S 2N3Y 2N9I 2N9J 3NWV 3ZCF 3ZOO 5EXQ 5TY3
  • DIP: 29683
  • STRING: ENSP00000307786
• Other Databases: GeneCards:  CYCS  Malacards:  CYCS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000159	protein phosphatase type 2A complex	TAS	cellular component
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005758	mitochondrial intermembrane space	TAS	cellular component
GO:0005758	mitochondrial intermembrane space	TAS	cellular component
GO:0005829	cytosol	IMP	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	IBA	biological process
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	TAS	biological process
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	IBA	biological process
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	TAS	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0007005	mitochondrion organization	TAS	biological process
GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	TAS	biological process
GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	TAS	biological process
GO:0020037	heme binding	TAS	molecular function
GO:0045155	electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity	IDA	molecular function
GO:0045333	cellular respiration	TAS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0070469	respiratory chain	IEA	cellular component
GO:0097193	intrinsic apoptotic signaling pathway	TAS	biological process
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0000159	protein phosphatase type 2A complex	TAS	cellular component
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	TAS	cellular component
GO:0005758	mitochondrial intermembrane space	TAS	cellular component
GO:0005829	cytosol	IMP	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	IBA	biological process
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	TAS	biological process
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	IBA	biological process
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	TAS	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0007005	mitochondrion organization	TAS	biological process
GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	TAS	biological process
GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	TAS	biological process
GO:0009055	electron carrier activity	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0020037	heme binding	TAS	molecular function
GO:0045155	electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity	IDA	molecular function
GO:0045333	cellular respiration	TAS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070469	respiratory chain	IEA	cellular component
GO:0097193	intrinsic apoptotic signaling pathway	TAS	biological process
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0000159	protein phosphatase type 2A complex	TAS	cellular component
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005758	mitochondrial intermembrane space	TAS	cellular component
GO:0005758	mitochondrial intermembrane space	TAS	cellular component
GO:0005829	cytosol	IMP	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	IBA	biological process
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	TAS	biological process
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	IBA	biological process
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	TAS	biological process
GO:0007005	mitochondrion organization	TAS	biological process
GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	TAS	biological process
GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	TAS	biological process
GO:0020037	heme binding	TAS	molecular function
GO:0045155	electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity	IDA	molecular function
GO:0045333	cellular respiration	TAS	biological process
GO:0097193	intrinsic apoptotic signaling pathway	TAS	biological process
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa00250	Alanine, aspartate and glutamate metabolism
hsa00260	Glycine, serine and threonine metabolism
hsa00260	Glycine, serine and threonine metabolism
hsa04120	Ubiquitin mediated proteolysis
hsa03460	Fanconi anemia pathway
hsa04015	Rap1 signaling pathway
hsa04010	MAPK signaling pathway
hsa04010	MAPK signaling pathway
hsa04010	MAPK signaling pathway
hsa04010	MAPK signaling pathway
hsa04010	MAPK signaling pathway
hsa04010	MAPK signaling pathway
hsa04012	ErbB signaling pathway
hsa04310	Wnt signaling pathway
hsa04310	Wnt signaling pathway
hsa04350	TGF-beta signaling pathway
hsa04350	TGF-beta signaling pathway
hsa04390	Hippo signaling pathway
hsa04390	Hippo signaling pathway
hsa04390	Hippo signaling pathway
hsa04370	VEGF signaling pathway
hsa04370	VEGF signaling pathway
hsa04371	Apelin signaling pathway
hsa04630	JAK-STAT signaling pathway
hsa04630	JAK-STAT signaling pathway
hsa04064	NF-kappa B signaling pathway
hsa04210	Apoptosis
hsa04215	Apoptosis - multiple species
hsa04115	p53 signaling pathway
hsa05200	Pathways in cancer
hsa05210	Colorectal cancer
hsa05222	Small cell lung cancer
hsa05010	Alzheimer disease
hsa05012	Parkinson disease
hsa05014	Amyotrophic lateral sclerosis
hsa05016	Huntington disease
hsa05416	Viral myocarditis
hsa04932	Non-alcoholic fatty liver disease
hsa05130	Pathogenic Escherichia coli infection
hsa05134	Legionellosis
hsa05152	Tuberculosis
hsa05170	Human immunodeficiency virus 1 infection
hsa05162	Measles
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05168	Herpes simplex virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05169	Epstein-Barr virus infection
hsa05145	Toxoplasmosis
hsa01524	Platinum drug resistance

Diseases

Associated diseases	References
Thrombocytopenia	KEGG: H00978
Male factor infertility	MIK: 12969693
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male factor infertility	MIK: 12969693
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
12969693	Male factor infertility			43 (35 patients with idiopathic infertility, 8 normal healthy donors)	Male infertility	cytochrome c caspases 9 and caspase 3
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray