• Gene id: 5420

Gene Summary

• Gene Symbol: PODXL   Gene   UCSC   Ensembl
• Aliases: Gp200, PC, PCLP, PCLP-1
• Gene name: podocalyxin like
• Alternate names: podocalyxin, GCTM-2 antigen, podocalyxin-like protein 1,
• Gene location: 7q32.3 (131556627: 131500270)     Exons: 9     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the sialomucin protein family. The encoded protein was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering
• OMIM: 606888

Protein Summary

• Protein general information: O00592  
  • Name: Podocalyxin (GCTM 2 antigen) (Gp200) (Podocalyxin like protein 1) (PC) (PCLP 1)
  • Length: 558  
  • Mass: 58635
  • Tissue specificity: Glomerular epithelium cell (podocyte).
• Sequence:

  MRCALALSALLLLLSTPPLLPSSPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEIL
  ASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQN
  GAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYT
  FTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTS
  PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEK
  LISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGP
  PEEAEDRFSMPLIITIVCMASFLLLVAALYGCCHQRLSQRKDQQRLTEELQTVENGYHDNPTLEVMETSSEMQEK
  KVVSLNGELGDSWIVPLDNLTKDDLDEEEDTHL

• Structural information:
  • Interpro: IPR013836  IPR017403  
  • DIP: 58638
  • STRING: ENSP00000367817
• Other Databases: GeneCards:  PODXL  Malacards:  PODXL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016477	cell migration	IBA	biological process
GO:0022408	negative regulation of cell-cell adhesion	IBA	biological process
GO:0032534	regulation of microvillus assembly	IBA	biological process
GO:0016324	apical plasma membrane	IBA	cellular component
GO:0031528	microvillus membrane	IBA	cellular component
GO:0033634	positive regulation of cell-cell adhesion mediated by integrin	IBA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0030175	filopodium	IDA	cellular component
GO:0001726	ruffle	IDA	cellular component
GO:0033634	positive regulation of cell-cell adhesion mediated by integrin	IDA	biological process
GO:0030027	lamellipodium	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0072175	epithelial tube formation	ISS	biological process
GO:0031528	microvillus membrane	ISS	cellular component
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0032534	regulation of microvillus assembly	ISS	biological process
GO:0022408	negative regulation of cell-cell adhesion	ISS	biological process
GO:0016477	cell migration	ISS	biological process
GO:0016477	cell migration	IEA	biological process
GO:0022407	regulation of cell-cell adhesion	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030175	filopodium	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0005902	microvillus	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0072015	glomerular visceral epithelial cell development	ISS	biological process
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0007162	negative regulation of cell adhesion	ISS	biological process
GO:0036057	slit diaphragm	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq