• Gene id: 54165

Gene Summary

• Gene Symbol: DCUN1D1   Gene   UCSC   Ensembl
• Aliases: DCNL1, DCUN1L1, RP42, SCCRO, SCRO, Tes3
• Gene name: defective in cullin neddylation 1 domain containing 1
• Alternate names: DCN1-like protein 1, DCN1, defective in cullin neddylation 1, domain containing 1, DCUN1 domain-containing protein 1, RP42 homolog, defective in cullin neddylation protein 1-like protein 1, squamous cell carcinoma-related oncogene,
• Gene location: 3q26.33 (73005931: 72954844)     Exons: 26     NC_000007.14
• OMIM: 605905

Protein Summary

• Protein general information: Q96GG9  
  • Name: DCN1 like protein 1 (DCUN1 domain containing protein 1) (Defective in cullin neddylation protein 1 like protein 1) (Squamous cell carcinoma related oncogene)
  • Length: 259  
  • Mass: 30124
  • Tissue specificity: Expressed in pancreas, kidney, placenta, brain and heart. Weakly or not expressed in liver, skeletal muscle and lung. Strongly overexpressed in thyroid tumors, bronchioloalveolar carcinomas, and malignant tissues of squamous cell carci
• Sequence:

  MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDP
  QDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKE
  PGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIAD
  DMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV

• Structural information:
  • Protein Domains: (8..4-)
    (/note="UBA-like-)
    (60..24-)
    (/note="DCUN1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00574"-)
  • Interpro: IPR014764  IPR042460  IPR005176  IPR009060  
  • Prosite: PS51229
  • PDB: 3TDU 3TDZ 4P5O 5UFI 5V83 5V86 5V88 6B5Q 6BG3 6BG5 6P5V 6P5W
  • PDBsum: 3TDU 3TDZ 4P5O 5UFI 5V83 5V86 5V88 6B5Q 6BG3 6BG5 6P5V 6P5W
  • DIP: 42121
  • STRING: ENSP00000292782
• Other Databases: GeneCards:  DCUN1D1  Malacards:  DCUN1D1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031624	ubiquitin conjugating enzyme binding	IBA	molecular function
GO:0097602	cullin family protein binding	IBA	molecular function
GO:0000151	ubiquitin ligase complex	IBA	cellular component
GO:0032182	ubiquitin-like protein binding	IBA	molecular function
GO:0045116	protein neddylation	IBA	biological process
GO:0051443	positive regulation of ubiquitin-protein transferase activity	IBA	biological process
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:2000436	positive regulation of protein neddylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenesis defects	MIK: 30653527
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
30653527	Spermatogenesis defects				Male infertility