• Gene id: 54149

Gene Summary

• Gene Symbol: C21orf91   Gene   UCSC   Ensembl
• Aliases: C21orf14, C21orf38, CSSG1, EURL, YG81
• Gene name: chromosome 21 open reading frame 91
• Alternate names: protein EURL homolog, cold sore susceptibility gene 1, early undifferentiated retina and lens,
• Gene location: 21q21.1 (17819355: 17788973)     Exons: 5     NC_000021.9
• OMIM: 605791

Protein Summary

• Protein general information: Q9NYK6  
  • Name: Protein EURL homolog
  • Length: 297  
  • Mass: 33948
  • Tissue specificity: Expressed in the brain (PubMed
• Sequence:

  MNEEEQFVNIDLNDDNICSVCKLGTDKETLSFCHICFELNIEGVPKSDLLHTKSLRGHKDCFEKYHLIANQGCPR
  SKLSKSTYEEVKTILSKKINWIVQYAQNKDLDSDSECSKNPQHHLFNFRHKPEEKLLPQFDSQVPKYSAKWIDGS
  AGGISNCTQRILEQRENTDFGLSMLQDSGATLCRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHYSREELNSM
  TLGEVEQLNAKLLQQIQEVFEELTHQVQEKDSLASQLHVRHVAIEQLLKNCSKLPCLQVGRTGMKSHLPINN

• Structural information:
  • Interpro: IPR009704  
  • STRING: ENSP00000284881
• Other Databases: GeneCards:  C21orf91  Malacards:  C21orf91

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060999	positive regulation of dendritic spine development	ISS	biological process
GO:0021895	cerebral cortex neuron differentiation	ISS	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0060999	positive regulation of dendritic spine development	IEA	biological process
GO:0021895	cerebral cortex neuron differentiation	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R