• Gene id: 54112

Gene Summary

• Gene Symbol: GPR88   Gene   UCSC   Ensembl
• Aliases: COCPMR, STRG
• Gene name: G protein-coupled receptor 88
• Alternate names: probable G-protein coupled receptor 88, striatum-specific G-protein coupled receptor,
• Gene location: 1p21.2 (100538138: 100542020)     Exons: 10     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a G protein-coupled receptor found almost exclusively in the striatum, a brain structure that controls motor function and cognition. Defects in this gene have been associated with chorea, speech delay, and learning diff
• OMIM: 607468

Protein Summary

• Protein general information: Q9GZN0  
  • Name: Probable G protein coupled receptor 88 (Striatum specific G protein coupled receptor)
  • Length: 384  
  • Mass: 40246
  • Tissue specificity: Expressed predominantly in the striatum. {ECO
• Sequence:

  MTNSSSTSTSSTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFRKLQTTSNAFIVNGCA
  ADLSVCALWMPQEAVLGLLPTGSAEPPADWDGAGGSYRLLRGGLLGLGLTVSLLSHCLVALNRYLLITRAPATYQ
  ALYQRRHTAGMLALSWALALGLVLLLPPWAPRPGAAPPRVHYPALLAAAALLAQTALLLHCYLGIVRRVRVSVKR
  VSVLNFHLLHQLPGCAAAAAAFPGAQHAPGPGGAAHPAQAQPLPPALHPRRAQRRLSGLSVLLLCCVFLLATQPL
  VWVSLASGFSLPVPWGVQAASWLLCCALSALNPLLYTWRNEEFRRSVRSVLPGVGDAAAAAVAATAVPAVSQAQL
  GTRAAGQHW

• Structural information:
  • Interpro: IPR000276  IPR017452  
  • Prosite: PS50262
  • STRING: ENSP00000314223
• Other Databases: GeneCards:  GPR88  Malacards:  GPR88

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071482	cellular response to light stimulus	IBA	biological process
GO:0008020	G protein-coupled photoreceptor activity	IBA	molecular function
GO:0007602	phototransduction	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0003774	motor activity	ISS	molecular function
GO:0005886	plasma membrane	ISS	cellular component
GO:0061743	motor learning	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005929	cilium	IDA	cellular component
GO:0003774	motor activity	IEA	molecular function
GO:0007626	locomotory behavior	IEA	biological process
GO:0019228	neuronal action potential	IEA	biological process
GO:0050885	neuromuscular process controlling balance	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0061743	motor learning	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0009584	detection of visible light	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	NAS	biological process

Diseases

Associated diseases	References
Chorea, childhood-onset, with psychomotor retardation	KEGG:H02367
Chorea, childhood-onset, with psychomotor retardation	KEGG:H02367
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)