• Gene id: 54108

Gene Summary

• Gene Symbol: CHRAC1   Gene   UCSC   Ensembl
• Aliases: CHARC1, CHARC15, CHRAC-1, CHRAC-15, CHRAC15, YCL1
• Gene name: chromatin accessibility complex subunit 1
• Alternate names: chromatin accessibility complex protein 1, DNA polymerase epsilon subunit p15, chromatin accessibility complex 1, chromatin accessibility complex 15 kDa protein, histone-fold protein CHRAC15,
• Gene location: 8q24.3 (140511321: 140517153)     Exons: 4     NC_000008.11
• Gene summary(Entrez): CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[s
• OMIM: 609163

Protein Summary

• Protein general information: Q9NRG0  
  • Name: Chromatin accessibility complex protein 1 (CHRAC 1) (Chromatin accessibility complex 15 kDa protein) (CHRAC 15) (HuCHRAC15) (DNA polymerase epsilon subunit p15)
  • Length: 131  
  • Mass: 14711
  • Tissue specificity: Expressed in all tissues tested, including, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
• Sequence:

  MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYS
  DLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS

• Structural information:
  • Interpro: IPR003958  IPR009072  
  • STRING: ENSP00000220913
• Other Databases: GeneCards:  CHRAC1  Malacards:  CHRAC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008623	CHRAC	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003887	DNA-directed DNA polymerase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0071897	DNA biosynthetic process	IEA	biological process
GO:0071897	DNA biosynthetic process	IEA	biological process
GO:0008623	CHRAC	NAS	cellular component
GO:0003677	DNA binding	NAS	molecular function
GO:0008622	epsilon DNA polymerase complex	NAS	cellular component
GO:0006338	chromatin remodeling	NAS	biological process
GO:0003887	DNA-directed DNA polymerase activity	NAS	molecular function
GO:0008623	CHRAC	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003887	DNA-directed DNA polymerase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0071897	DNA biosynthetic process	IEA	biological process
GO:0071897	DNA biosynthetic process	IEA	biological process
GO:0008623	CHRAC	NAS	cellular component
GO:0003677	DNA binding	NAS	molecular function
GO:0008622	epsilon DNA polymerase complex	NAS	cellular component
GO:0006338	chromatin remodeling	NAS	biological process
GO:0003887	DNA-directed DNA polymerase activity	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq