• Gene id: 54107

Gene Summary

• Gene Symbol: POLE3   Gene   UCSC   Ensembl
• Aliases: CHARAC17, CHRAC17, CHRAC2, YBL1, p17
• Gene name: DNA polymerase epsilon 3, accessory subunit
• Alternate names: DNA polymerase epsilon subunit 3, CHRAC-17, DNA polymerase II subunit 3, DNA polymerase epsilon p17 subunit, DNA polymerase epsilon subunit p17, arsenic transactivated protein, asTP, chromatin accessibility complex 17 kDa protein, chromatin accessibility complex ,
• Gene location: 9q32 (113410748: 113407234)     Exons: 5     NC_000009.12
• Gene summary(Entrez): POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[su
• OMIM: 607267

Protein Summary

• Protein general information: Q9NRF9  
  • Name: DNA polymerase epsilon subunit 3 (Arsenic transactivated protein) (AsTP) (Chromatin accessibility complex 17 kDa protein) (CHRAC 17) (HuCHRAC17) (DNA polymerase II subunit 3) (DNA polymerase epsilon subunit p17)
  • Length: 147  
  • Mass: 16860
  • Tissue specificity: Expressed in all tissues tested, including, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
• Sequence:

  MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEE
  MEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN

• Structural information:
  • Interpro: IPR003958  IPR009072  
  • STRING: ENSP00000363286
• Other Databases: GeneCards:  POLE3  Malacards:  POLE3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008622	epsilon DNA polymerase complex	IBA	cellular component
GO:0006272	leading strand elongation	IBA	biological process
GO:0006974	cellular response to DNA damage stimulus	IBA	biological process
GO:0008623	CHRAC	IBA	cellular component
GO:0031490	chromatin DNA binding	IBA	molecular function
GO:0031507	heterochromatin assembly	IBA	biological process
GO:0042766	nucleosome mobilization	IBA	biological process
GO:0008622	epsilon DNA polymerase complex	IDA	cellular component
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003887	DNA-directed DNA polymerase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006270	DNA replication initiation	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IDA	cellular component
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0071897	DNA biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa03420	Nucleotide excision repair
hsa03030	DNA replication
hsa03410	Base excision repair

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)