• Gene id: 54106

Gene Summary

• Gene Symbol: TLR9   Gene   UCSC   Ensembl
• Aliases: CD289
• Gene name: toll like receptor 9
• Alternate names: toll-like receptor 9,
• Gene location: 3p21.2 (52226162: 52221079)     Exons: 2     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the Toll-like receptor (TLR) family, which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and fun
• OMIM: 601713

Protein Summary

• Protein general information: Q9NR96  
  • Name: Toll like receptor 9 (CD antigen CD289)
  • Length: 1032  
  • Mass: 115860
  • Tissue specificity: Highly expressed in spleen, lymph node, tonsil and peripheral blood leukocytes, especially in plasmacytoid pre-dendritic cells. Levels are much lower in monocytes and CD11c+ immature dendritic cells. Also detected in lung and liver.
• Sequence:

  MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAAPRGNVTSLSLSSNRI
  HHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSL
  SHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYL
  LLSYNRIVKLAPEDLANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
  ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSFGSLVALKELDMHGIF
  FRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYVDLSDNRISGASELTATMGEADGGEKVWLQP
  GDLAPAPVDTPSSEDFRPNCSTLNFTLDLSRNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQV
  LDLSHNKLDLYHEHSFTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
  RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRLRDNYLAFFKWWSLHF
  LPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGFFSKAKELRELNLSANALKTVDHSWFGPLAS
  ALQILDVSANPLHCACGAAFMDFLLEVQAAVPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLA
  VALGLGVPMLHHLCGWDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG
  RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLEDRKDVVVLVILSPDG
  RRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHFYNRNFCQGPTAE

• Structural information:
  • Protein Domains: (868..101-)
    (/note="TIR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00204"-)
  • Interpro: IPR001611  IPR003591  IPR041283  IPR000157  IPR027181   IPR035897  
  • Prosite: PS51450 PS50104
  • DIP: 52371
  • STRING: ENSP00000417517
• Other Databases: GeneCards:  TLR9  Malacards:  TLR9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901895	negative regulation of ATPase-coupled calcium transmembrane transporter activity	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0032640	tumor necrosis factor production	IDA	biological process
GO:0032755	positive regulation of interleukin-6 production	IBA	biological process
GO:0045078	positive regulation of interferon-gamma biosynthetic process	IBA	biological process
GO:0045359	positive regulation of interferon-beta biosynthetic process	IBA	biological process
GO:0045416	positive regulation of interleukin-8 biosynthetic process	IBA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:0051607	defense response to virus	IBA	biological process
GO:0002224	toll-like receptor signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0006955	immune response	IBA	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0032640	tumor necrosis factor production	IBA	biological process
GO:0038187	pattern recognition receptor activity	IBA	molecular function
GO:0002639	positive regulation of immunoglobulin production	IDA	biological process
GO:0045577	regulation of B cell differentiation	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0034163	regulation of toll-like receptor 9 signaling pathway	IDA	biological process
GO:0050871	positive regulation of B cell activation	IDA	biological process
GO:0030890	positive regulation of B cell proliferation	IDA	biological process
GO:0036019	endolysosome	ISS	cellular component
GO:0032009	early phagosome	ISS	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0005768	endosome	ISS	cellular component
GO:0005764	lysosome	ISS	cellular component
GO:0002237	response to molecule of bacterial origin	IEA	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0050707	regulation of cytokine secretion	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IEA	biological process
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0034162	toll-like receptor 9 signaling pathway	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0034162	toll-like receptor 9 signaling pathway	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0036020	endolysosome membrane	TAS	cellular component
GO:0036020	endolysosome membrane	TAS	cellular component
GO:0036020	endolysosome membrane	TAS	cellular component
GO:0007252	I-kappaB phosphorylation	IDA	biological process
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0032722	positive regulation of chemokine production	IDA	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0002237	response to molecule of bacterial origin	TAS	biological process
GO:0032733	positive regulation of interleukin-10 production	ISS	biological process
GO:0032741	positive regulation of interleukin-18 production	ISS	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0032717	negative regulation of interleukin-8 production	IDA	biological process
GO:0034122	negative regulation of toll-like receptor signaling pathway	IDA	biological process
GO:0034123	positive regulation of toll-like receptor signaling pathway	IDA	biological process
GO:1901224	positive regulation of NIK/NF-kappaB signaling	IDA	biological process
GO:0043507	positive regulation of JUN kinase activity	IDA	biological process
GO:0046330	positive regulation of JNK cascade	IC	biological process
GO:0030277	maintenance of gastrointestinal epithelium	ISS	biological process
GO:0032715	negative regulation of interleukin-6 production	ISS	biological process
GO:0032728	positive regulation of interferon-beta production	ISS	biological process
GO:0032735	positive regulation of interleukin-12 production	ISS	biological process
GO:0032760	positive regulation of tumor necrosis factor production	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	ISS	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0045356	positive regulation of interferon-alpha biosynthetic process	IDA	biological process
GO:0045359	positive regulation of interferon-beta biosynthetic process	IDA	biological process
GO:0045078	positive regulation of interferon-gamma biosynthetic process	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	IMP	biological process
GO:0042742	defense response to bacterium	NAS	biological process
GO:0035197	siRNA binding	IMP	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005149	interleukin-1 receptor binding	IPI	molecular function
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0045322	unmethylated CpG binding	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa05132	Salmonella infection
hsa05152	Tuberculosis
hsa05162	Measles
hsa04620	Toll-like receptor signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05142	Chagas disease
hsa05144	Malaria
hsa05143	African trypanosomiasis

Diseases

Associated diseases	References
Atopic dermatitis	KEGG:H01358
Atopic dermatitis	KEGG:H01358
Lupus nephritis	PMID:19578108
Lupus nephritis	PMID:20497632
Non-alcoholic fatty liver disease	PMID:28687713
Primary biliary cirrhosis	PMID:23026026
cardiovascular system disease	PMID:20604744
Cystic fibrosis	PMID:20837493
Breast cancer	PMID:18922969
Squamous cell carcinoma	PMID:17440926
Bronchiolitis obliterans	PMID:20227302
Asthma	PMID:20072849
Asthma	PMID:18312481
Interstitial lung disease	PMID:18633634
Chronic granulomatous disease	PMID:18155283
Pulmonary fibrosis	PMID:18633634
lung non-small cell carcinoma	PMID:15631627
renal cell carcinoma	PMID:21929816
Proteinuria	PMID:22787315
hepatocellular carcinoma	PMID:18215354
hepatocellular carcinoma	PMID:24452201
Chronic kidney disease	PMID:21908957
cervix uteri carcinoma in situ	PMID:17440926
Systemic lupus erythematosus	PMID:19130296
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881