• Gene id: 54102

Gene Summary

• Gene Symbol: CLIC6   Gene   UCSC   Ensembl
• Aliases: CLIC1L
• Gene name: chloride intracellular channel 6
• Alternate names: chloride intracellular channel protein 6, chloride channel form A, parchorin,
• Gene location: 21q22.12 (34668952: 34718222)     Exons: 7     NC_000021.9
• Gene summary(Entrez): This gene encodes a member of the chloride intracellular channel family of proteins. The gene is part of a large triplicated region found on chromosomes 1, 6, and 21. Alternative splicing results in multiple transcript variants encoding different isoforms
• OMIM: 608473

Protein Summary

• Protein general information: Q96NY7  
  • Name: Chloride intracellular channel protein 6 (Parchorin)
  • Length: 704  
  • Mass: 73012
  • Tissue specificity: Expressed in brain, placenta, pancreas and liver. {ECO
• Sequence:

  MAEAAEPEGVAPGPQGPPEVPAPLAERPGEPGAAGGEAEGPEGSEGAEEAPRGAAAVKEAGGGGPDRGPEAEARG
  TRGAHGETEAEEGAPEGAEVPQGGEETSGAQQVEGASPGRGAQGEPRGEAQREPEDSAAPERQEEAEQRPEVPEG
  SASGEAGDSVDAEGPLGDNIEAEGPAGDSVEAEGRVGDSVDAEGPAGDSVDAEGPLGDNIQAEGPAGDSVDAEGR
  VGDSVDAEGPAGDSVDAEGRVGDSVEAGDPAGDGVEAGVPAGDSVEAEGPAGDSMDAEGPAGRARRVSGEPQQSG
  DGSLSPQAEAIEVAAGESAGRSPGELAWDAAEEAEVPGVKGSEEAAPGDARADAGEDRVGDGPQQEPGEDEERRE
  RSPEGPREEEAAGGEEESPDSSPHGEASRGAAEPEAQLSNHLAEEGPAEGSGEAARVNGRREDGEASEPRALGQE
  HDITLFVKVKLTALGCSRIAIKKYLRAGYDGESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGT
  NPPFMTFDGEVKTDVNKIEEFLEEKLAPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIHEKNLLKAL
  RKLDNYLNSPLPDEIDAYSTEDVTVSGRKFLDGDELTLADCNLLPKLHIIKIVAKKYRDFEFPSEMTGIWRYLNN
  AYARDEFTNTCPADQEIEHAYSDVAKRMK

• Structural information:
  • Protein Domains: (556..70-)
    (/note="GST-C-terminal")
  • Interpro: IPR002946  IPR010987  IPR036282  IPR040079  IPR036249  
  • Prosite: PS50405
  • STRING: ENSP00000290332
• Other Databases: GeneCards:  CLIC6  Malacards:  CLIC6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0031751	D4 dopamine receptor binding	IBA	molecular function
GO:0031749	D2 dopamine receptor binding	IBA	molecular function
GO:0031750	D3 dopamine receptor binding	IBA	molecular function
GO:0006821	chloride transport	IEA	biological process
GO:0034707	chloride channel complex	IEA	cellular component
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0005254	chloride channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881