• Gene id: 5408

Gene Summary

• Gene Symbol: PNLIPRP2   Gene   UCSC   Ensembl
• Aliases: PLRP2
• Gene name: pancreatic lipase related protein 2 (gene/pseudogene)
• Alternate names: pancreatic lipase-related protein 2, PL-RP2, galactolipase,
• Gene location: 10q25.3 (116620952: 116645142)     Exons: 13     NC_000010.11
• Gene summary(Entrez): This gene encodes a lipase that hydrolyzes galactolipids, the main components of plant membrane lipids. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the non-coding allele. [provided b
• OMIM: 136950

Protein Summary

• Protein general information: P54317  
  • Name: Pancreatic lipase related protein 2 (PL RP2) (EC 3.1.1.26) (EC 3.1.1.3) (Galactolipase)
  • Length: 469  
  • Mass: 51961
  • Tissue specificity: Pancreas.
• Sequence:

  MLPPWTLGLLLLATVRGKEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEP
  DTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFL
  IQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDS
  SPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFL
  GYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKISVTLSGKEKVNGYI
  RIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEY
  NFCSSDTVEENVLQSLYPC

• Structural information:
  • Protein Domains: (357..46-)
    (/note="PLAT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00152"-)
  • Interpro: IPR029058  IPR013818  IPR016272  IPR033906  IPR002331   IPR001024  IPR036392  IPR000734  
  • Prosite: PS00120 PS50095
  • CDD: cd00707
  • PDB: 2OXE 2PVS
  • PDBsum: 2OXE 2PVS
• Other Databases: GeneCards:  PNLIPRP2  Malacards:  PNLIPRP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016298	lipase activity	IBA	molecular function
GO:0009395	phospholipid catabolic process	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0004620	phospholipase activity	IBA	molecular function
GO:0047714	galactolipase activity	IBA	molecular function
GO:0016042	lipid catabolic process	IBA	biological process
GO:0004806	triglyceride lipase activity	IBA	molecular function
GO:0019376	galactolipid catabolic process	IDA	biological process
GO:0009395	phospholipid catabolic process	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0004620	phospholipase activity	IDA	molecular function
GO:0047714	galactolipase activity	IDA	molecular function
GO:0047372	acylglycerol lipase activity	IDA	molecular function
GO:0004806	triglyceride lipase activity	ISS	molecular function
GO:0004806	triglyceride lipase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0052689	carboxylic ester hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0004806	triglyceride lipase activity	TAS	molecular function
GO:0006641	triglyceride metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0047714	galactolipase activity	IEA	molecular function
GO:0004806	triglyceride lipase activity	IEA	molecular function
GO:0102549	1-18:1-2-16:0-monogalactosyldiacylglycerol lipase activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0044241	lipid digestion	TAS	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0044258	intestinal lipid catabolic process	IEA	biological process
GO:0004806	triglyceride lipase activity	IEA	molecular function
GO:0006968	cellular defense response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04972	Pancreatic secretion
hsa00561	Glycerolipid metabolism
hsa04975	Fat digestion and absorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881