• Gene id: 5406

Gene Summary

• Gene Symbol: PNLIP   Gene   UCSC   Ensembl
• Aliases: PL, PNLIPD, PTL
• Gene name: pancreatic lipase
• Alternate names: pancreatic triacylglycerol lipase, triacylglycerol acylhydrolase, triacylglycerol lipase,
• Gene location: 10q25.3 (116545930: 116567854)     Exons: 13     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the lipase family of proteins. The encoded enzyme is secreted by the pancreas and hydrolyzes triglycerides in the small intestine, and is essential for the efficient digestion of dietary fats. Inhibition of the encoded enzyme
• OMIM: 612193

Protein Summary

• Protein general information: P16233  
  • Name: Pancreatic triacylglycerol lipase (PL) (PTL) (Pancreatic lipase) (EC 3.1.1.3)
  • Length: 465  
  • Mass: 51157
• Sequence:

  MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTNENPNNFQEVAADSSS
  ISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVE
  FLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAP
  IVPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF
  PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILVS
  LFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWYNNVINPTLPRVGASKIIVETNVGKQFNFCS
  PETVREEVLLTLTPC

• Structural information:
  • Protein Domains: (355..46-)
    (/note="PLAT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00152"-)
  • Interpro: IPR029058  IPR013818  IPR016272  IPR033906  IPR002331   IPR001024  IPR036392  IPR000734  
  • Prosite: PS00120 PS50095
  • CDD: cd00707
  • PDB: 1GPL 1LPA 1LPB 1N8S
  • PDBsum: 1GPL 1LPA 1LPB 1N8S
  • STRING: ENSP00000358223
• Other Databases: GeneCards:  PNLIP  Malacards:  PNLIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061365	positive regulation of triglyceride lipase activity	IDA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0016298	lipase activity	IBA	molecular function
GO:0004806	triglyceride lipase activity	IBA	molecular function
GO:0016042	lipid catabolic process	IBA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0016298	lipase activity	IDA	molecular function
GO:0006629	lipid metabolic process	IMP	biological process
GO:0004806	triglyceride lipase activity	ISS	molecular function
GO:0004806	triglyceride lipase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0052689	carboxylic ester hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0004806	triglyceride lipase activity	TAS	molecular function
GO:0004806	triglyceride lipase activity	IEA	molecular function
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0044241	lipid digestion	TAS	biological process
GO:0030299	intestinal cholesterol absorption	IEA	biological process
GO:0004806	triglyceride lipase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04972	Pancreatic secretion
hsa00561	Glycerolipid metabolism
hsa04975	Fat digestion and absorption
hsa04977	Vitamin digestion and absorption

Diseases

Associated diseases	References
Pancreatic lipase deficiency	KEGG:H02330
Pancreatic lipase deficiency	KEGG:H02330
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R