• Gene id: 54059

Gene Summary

• Gene Symbol: YBEY   Gene   UCSC   Ensembl
• Aliases: C21orf57
• Gene name: ybeY metalloendoribonuclease
• Alternate names: endoribonuclease YbeY, putative metalloprotease C21orf57, putative ribonuclease, rRNA maturation factor homolog, ybeY metallopeptidase (putative),
• Gene location: 21q22.3 (46286055: 46314187)     Exons: 10     NC_000021.9
• Gene summary(Entrez): This gene encodes a highly conserved metalloprotein. A similar protein in bacteria acts as an endoribonuclease, and is thought to function in ribosomal RNA maturation and ribosome assembly. Alternative splicing results in multiple transcript variants. [pr
• OMIM: 617461

Protein Summary

• Protein general information: P58557  
  • Name: Endoribonuclease YbeY (EC 3.1. . )
  • Length: 167  
  • Mass: 19298
• Sequence:

  MSLVIRNLQRVIPIRRAPLRSKIEIVRRILGVQKFDLGIICVDNKNIQHINRIYRDRNVPTDVLSFPFHEHLKAG
  EFPQPDFPDDYNLGDIFLGVEYIFHQCKENEDYNDVLTVTATHGLCHLLGFTHGTEAEWQQMFQKEKAVLDELGR
  RTGTRLQPLTRGLFGGS

• Structural information:
  • Interpro: IPR023091  IPR002036  IPR020549  
  • Prosite: PS01306
  • STRING: ENSP00000329614
• Other Databases: GeneCards:  YBEY  Malacards:  YBEY

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004521	endoribonuclease activity	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0004521	endoribonuclease activity	IDA	molecular function
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0006364	rRNA processing	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0005634	nucleus	IDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R