• Gene id: 54020

Gene Summary

• Gene Symbol: SLC37A1   Gene   UCSC   Ensembl
• Aliases: G3PP
• Gene name: solute carrier family 37 member 1
• Alternate names: glucose-6-phosphate exchanger SLC37A1, G-3-P permease, G-3-P transporter, glycerol-3-phosphate permease, glycerol-3-phosphate transporter, solute carrier family 37 (glucose-6-phosphate transporter), member 1, solute carrier family 37 (glycerol-3-phosphate trans,
• Gene location: 21q22.3 (42499621: 42581435)     Exons: 26     NC_000021.9
• Gene summary(Entrez): The protein encoded by this gene localizes to the endoplasmic reticulum (ER) membrane. This protein translocates glucose-6-phosphate from the cytoplasm into the lumen of the ER for hydrolysis into glucose by another ER membrane protein. This gene is a mem
• OMIM: 605276

Protein Summary

• Protein general information: P57057  
  • Name: Glucose 6 phosphate exchanger SLC37A1 (Glycerol 3 phosphate permease) (G 3 P permease) (Solute carrier family 37 member 1)
  • Length: 533  
  • Mass: 57648
  • Tissue specificity: Expressed in numerous tissues, with highest expression in pancreas, kidney, bone marrow, spleen, liver, small intestine, as well as in fetal brain, liver and spleen. {ECO
• Sequence:

  MARLPAGIRFIISFSRDQWYRAFIFILTFLLYASFHLSRKPISIVKGELHKYCTAWDEADVRFSSQNRKSGSAAP
  HQLPDNETDCGWAPFDKNNYQQLLGALDYSFLCAYAVGMYLSGIIGERLPIRYYLTFGMLASGAFTALFGLGYFY
  NIHSFGFYVVTQVINGLVQTTGWPSVVTCLGNWFGKGRRGLIMGVWNSHTSVGNILGSLIAGYWVSTCWGLSFVV
  PGAIVAAMGIVCFLFLIEHPNDVRCSSTLVTHSKGYENGTNRLRLQKQILKSEKNKPLDPEMQCLLLSDGKGSIH
  PNHVVILPGDGGSGTAAISFTGALKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLDAKKAGELSTLFDVG
  GIFGGILAGVISDRLEKRASTCGLMLLLAAPTLYIFSTVSKMGLEATIAMLLLSGALVSGPYTLITTAVSADLGT
  HKSLKGNAHALSTVTAIIDGTGSVGAALGPLLAGLLSPSGWSNVFYMLMFADACALLFLIRLIHKELSCPGSATG
  DQVPFKEQ

• Structural information:
  • Interpro: IPR011701  IPR020846  IPR036259  IPR000849  
  • Prosite: PS50850
  • STRING: ENSP00000344648
• Other Databases: GeneCards:  SLC37A1  Malacards:  SLC37A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035435	phosphate ion transmembrane transport	IBA	biological process
GO:0015760	glucose-6-phosphate transport	IBA	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IBA	cellular component
GO:0061513	glucose 6-phosphate:inorganic phosphate antiporter activity	IBA	molecular function
GO:0061513	glucose 6-phosphate:inorganic phosphate antiporter activity	IDA	molecular function
GO:0015760	glucose-6-phosphate transport	IDA	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:0035435	phosphate ion transmembrane transport	IDA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0015297	antiporter activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0015760	glucose-6-phosphate transport	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq