• Gene id: 53981

Gene Summary

• Gene Symbol: CPSF2   Gene   UCSC   Ensembl
• Aliases: CPSF100
• Gene name: cleavage and polyadenylation specific factor 2
• Alternate names: cleavage and polyadenylation specificity factor subunit 2, CPSF 100 kDa subunit, CPSF 100kDa subunit, cleavage and polyadenylation specific factor 2, 100kDa, cleavage and polyadenylation specificity factor 100 kDa subunit,
• Gene location: 14q32.12 (92121968: 92172144)     Exons: 16     NC_000014.9
• OMIM: 606028

Protein Summary

• Protein general information: Q9P2I0  
  • Name: Cleavage and polyadenylation specificity factor subunit 2 (Cleavage and polyadenylation specificity factor 100 kDa subunit) (CPSF 100 kDa subunit)
  • Length: 782  
  • Mass: 88487
• Sequence:

  MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLLSHPDPLHLGALPYAV
  GKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFTLFTLDDVDAAFDKIQQLKFSQIVNLKGKGHGLSITPLP
  AGHMIGGTIWKIVKDGEEEIVYAVDFNHKREIHLNGCSLEMLSRPSLLITDSFNATYVQPRRKQRDEQLLTNVLE
  TLRGDGNVLIAVDTAGRVLELAQLLDQIWRTKDAGLGVYSLALLNNVSYNVVEFSKSQVEWMSDKLMRCFEDKRN
  NPFQFRHLSLCHGLSDLARVPSPKVVLASQPDLECGFSRDLFIQWCQDPKNSIILTYRTTPGTLARFLIDNPSEK
  ITEIELRKRVKLEGKELEEYLEKEKLKKEAAKKLEQSKEADIDSSDESDIEEDIDQPSAHKTKHDLMMKGEGSRK
  GSFFKQAKKSYPMFPAPEERIKWDEYGEIIKPEDFLVPELQATEEEKSKLESGLTNGDEPMDQDLSDVPTKCIST
  TESIEIKARVTYIDYEGRSDGDSIKKIINQMKPRQLIIVHGPPEASQDLAECCRAFGGKDIKVYMPKLHETVDAT
  SETHIYQVRLKDSLVSSLQFCKAKDAELAWIDGVLDMRVSKVDTGVILEEGELKDDGEDSEMQVEAPSDSSVIAQ
  QKAMKSLFGDDEKETGEESEIIPTLEPLPPHEVPGHQSVFMNEPRLSDFKQVLLREGIQAEFVGGVLVCNNQVAV
  RRTETGRIGLEGCLCQDFYRIRDLLYEQYAIV

• Structural information:
  • Interpro: IPR022712  IPR027075  IPR025069  IPR035639  IPR001279   IPR036866  IPR011108  
  • CDD: cd16293
  • PDB: 6URG
  • PDBsum: 6URG
  • DIP: 42500
  • STRING: ENSP00000298875
• Other Databases: GeneCards:  CPSF2  Malacards:  CPSF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003723	RNA binding	IBA	molecular function
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IBA	cellular component
GO:0006378	mRNA polyadenylation	IBA	biological process
GO:0098789	pre-mRNA cleavage required for polyadenylation	IBA	biological process
GO:0006398	mRNA 3'-end processing by stem-loop binding and cleavage	IBA	biological process
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IDA	cellular component
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IEA	cellular component
GO:0006378	mRNA polyadenylation	IEA	biological process
GO:0006379	mRNA cleavage	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006369	termination of RNA polymerase II transcription	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006398	mRNA 3'-end processing by stem-loop binding and cleavage	IDA	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)